Skip to main content

Semaglutide

Also known as: Ozempic, Wegovy, Rybelsus

Research compiled by Peptide Protocol Wiki
๐Ÿ“…Updated July 24, 2026
Citations verified: January 31, 2026
Citations Verified January 31, 2026
New to metabolic peptides?Browse all metabolic peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขFDA-approved for type 2 diabetes (Ozempic) and weight management (Wegovy)
  • โ€ขSelective GLP-1 receptor agonist with proven cardiovascular benefit (SELECT trial)
  • โ€ขAvailable in both injectable and oral formulations (Rybelsus)
  • โ€ขDemonstrated 14.9-16.0% body weight reduction in clinical trials
  • โ€ข20% reduction in MACE independent of diabetes status (SELECT trial)

Community-Reported Side EffectsAnecdotal?

Protocol Quick-Reference

Weight management (Wegovy) and type 2 diabetes (Ozempic/Rybelsus)

Dosing

Amount

0.25 mg starting, escalating to 2.4 mg (Wegovy) or 0.5-2 mg (Ozempic)

Frequency

Once weekly (injectable); once daily (oral)

Duration

Ongoing (chronic therapy)

Step-wise Titration (16 weeks)

Administration

Route

SC

Schedule

Once weekly (injectable); once daily (oral)

Timing

Same day each week, any time of day (injectable); first thing in morning on empty stomach (oral)

โœ“ Rotate injection sites

Cycle

Duration

Ongoing (chronic therapy)

Repeatable

Yes

Preparation & Storage

โœ“ Ready-to-use โ€” no reconstitution required

Storage: Store refrigerated at 2-8 degrees C (36-46 degrees F). Do not freeze. Ozempic: after first use, pen may be stored at room temperature (up to 30 degrees C / 86 degrees F) or refrigerated for up to 56 days. Wegovy: store refrigerated; single-dose pens used once then discarded. Rybelsus tablets: store at room temperature up to 30 degrees C in original blister packaging to protect from moisture.

โš—๏ธ Suggested Bloodwork (6 tests)

HbA1c and fasting glucose

When: Baseline

Why: Baseline glycemic control

Lipid panel

When: Baseline

Why: Baseline cardiovascular markers

CMP with liver enzymes

When: Baseline

Why: Liver and kidney function

Thyroid panel (TSH, free T4)

When: Baseline

Why: Rule out thyroid disorders (black box MTC warning)

Amylase and lipase

When: Baseline

Why: Baseline pancreatic function

HbA1c

When: 12 weeks

Why: Monitor glycemic improvement

๐Ÿ’ก Key Considerations
  • โ†’Rybelsus requires strict fasting protocol: empty stomach, <=4oz water, wait 30 min before eating
  • โ†’Contraindication: Avoid with personal/family history of medullary thyroid carcinoma or MEN2 syndrome; contraindicated in pregnancy

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates โ€” free.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for Semaglutide
How Semaglutide works at the cellular level
Key benefits and uses of Semaglutide
Overview of Semaglutide benefits and applications
Scientific Details
Molecular Formula
C187H291N45O59
Molecular Weight
4113.58 Da
CAS Number
910463-68-2
Sequence
His-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG with C18 fatty diacid at Lys26

What is Semaglutide?#

Semaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist developed by Novo Nordisk. It is a 31-amino-acid synthetic peptide analog of human GLP-1(7-37) with two key modifications: an alpha-aminoisobutyric acid (Aib) substitution at position 8 for DPP-4 resistance, and a C18 fatty diacid chain conjugated at lysine-26 via a mini-PEG linker, enabling non-covalent albumin binding and a half-life of approximately 7 days1.

Semaglutide is marketed under three brand names covering distinct indications and formulations:

  • Ozempic (injectable): FDA-approved December 2017 for type 2 diabetes mellitus, available in 0.25 mg, 0.5 mg, 1 mg, and 2 mg weekly doses
  • Rybelsus (oral tablet): FDA-approved September 2019 as the first oral GLP-1 receptor agonist for type 2 diabetes, available in 3 mg, 7 mg, and 14 mg daily doses
  • Wegovy (injectable): FDA-approved June 2021 for chronic weight management in adults with obesity (BMI โ‰ฅ30) or overweight (BMI โ‰ฅ27) with at least one weight-related comorbidity, at the 2.4 mg weekly dose

Mechanism of Action#

Semaglutide mimics the effects of the endogenous incretin hormone GLP-1, which is released from intestinal L-cells after food intake. By selectively activating the GLP-1 receptor, semaglutide produces multiple coordinated metabolic effects.

Incretin Signaling#

  • Glucose-dependent insulin secretion: Stimulates pancreatic beta-cells to release insulin only when blood glucose is elevated, reducing the risk of hypoglycemia compared to insulin or sulfonylureas
  • Glucagon suppression: Inhibits inappropriate glucagon secretion from alpha-cells in the hyperglycemic state, reducing hepatic glucose output
  • Gastric emptying delay: Slows the rate at which food passes from the stomach into the small intestine, reducing postprandial glucose excursions and contributing to satiety
  • Central appetite regulation: Acts on GLP-1 receptors in the hypothalamus and brainstem to reduce hunger, increase satiety, and modify food preferences away from high-fat and high-calorie options

Pharmacokinetics#

The C18 fatty diacid (octadecanedioic acid) modification at Lys26 is the key structural feature enabling once-weekly dosing. This acyl chain binds non-covalently to serum albumin, creating a circulating reservoir that shields the peptide from renal filtration and enzymatic degradation. The resulting half-life of approximately 7 days (168 hours) allows for once-weekly subcutaneous injection. Steady-state concentrations are achieved after approximately 4-5 weeks of weekly dosing.

Research Overview#

Semaglutide has one of the most extensive clinical evidence bases of any GLP-1 receptor agonist, spanning multiple phase 3 programs: SUSTAIN (type 2 diabetes, injectable), PIONEER (type 2 diabetes, oral), STEP (obesity/weight management), and SELECT (cardiovascular outcomes in obesity). Collectively, these programs have enrolled over 25,000 participants, providing high-quality evidence across multiple indications (Wilding JPH et al., NEJM 2021; PMID 335671851; Lincoff AM et al., NEJM 2023; PMID 379521312; Marso SP et al., NEJM 2016; PMID 276331863).

The SELECT trial (Lincoff AM et al., NEJM 2023; PMID 37952131) demonstrated that semaglutide 2.4 mg weekly reduced major adverse cardiovascular events (MACE) by 20% (HR 0.80, 95% CI 0.72-0.90, P<0.001) over a mean follow-up of 39.8 months in 17,604 adults with established cardiovascular disease and overweight/obesity but without diabetes, establishing semaglutide as the first anti-obesity medication with proven cardiovascular benefit2.

Important Considerations#

  • Prescription medication requiring medical supervision
  • Contraindicated in patients with personal or family history of medullary thyroid carcinoma or MEN2
  • Most common adverse events are gastrointestinal (nausea, vomiting, diarrhea)
  • Dose escalation schedule important to minimize GI side effects
  • Discontinue at least 2 months before planned pregnancy

Key Research Findings#

Semaglutide and Cardiovascular Outcomes in Patients with Type 2 Diabetes (SUSTAIN-6), published in New England Journal of Medicine (Marso SP et al., 2016; PMID: 27633186):

  • The study showed MACE reduction of 26% (HR 0.74, 95% CI 0.58-0.95, P=0.02)
  • The study showed non fatal stroke reduced by 39%
  • The study showed non fatal MI reduced by 26%
  • SUSTAIN-6 was a cardiovascular outcomes trial evaluating semaglutide in 3,297 patients with T2D and high cardiovascular risk. Semaglutide significantly reduced MACE by 26% compared to placebo over a median follow up of 2.1 years.

Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP 1), published in New England Journal of Medicine (Wilding JPH et al., 2021; PMID: 33567185):

  • The study demonstrated mean weight loss of 14.9% vs 2.4% at 68 weeks

Semaglutide and Cardiovascular Outcomes in Patients with Overweight or Obesity (SELECT), published in New England Journal of Medicine (Lincoff AM et al., 2023; PMID: 37952131):

  • The study showed MACE reduction of 20% (HR 0.80, 95% CI 0.72-0.90, P<0.001)
  • The study showed mean weight loss of 9.4% vs 0.9% in placebo
  • SELECT was a landmark cardiovascular outcomes trial evaluating semaglutide 2.4 mg weekly in 17,604 adults with established cardiovascular disease and overweight/obesity but without diabetes. Semaglutide reduced MACE by 20% over a mean follow up of 39.8 months.

References#

Footnotes#

  1. Wilding JPH, Batterham RL, Calanna S, et al. Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP 1). New England Journal of Medicine. 2021. PMID: 33567185. DOI: 10.1056/NEJMoa2032183. โ†ฉ โ†ฉ2

  2. Lincoff AM, Brown-Frandsen K, Colhoun HM, et al. Semaglutide and Cardiovascular Outcomes in Patients with Overweight or Obesity (SELECT). New England Journal of Medicine. 2023. PMID: 37952131. DOI: 10.1056/NEJMoa2307563. โ†ฉ โ†ฉ2

  3. Marso SP, Bain SC, Consoli A, et al. Semaglutide and Cardiovascular Outcomes in Patients with Type 2 Diabetes (SUSTAIN-6). New England Journal of Medicine. 2016. PMID: 27633186. DOI: 10.1056/NEJMoa1607141. โ†ฉ

Stay current on Semaglutide research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 500+ community reports

View community protocols

Frequently Asked Questions About Semaglutide

Is semaglutide a peptide?

Yes. Semaglutide is a 31-amino acid peptide analog of human GLP-1 (glucagon-like peptide-1) with a C18 fatty diacid chain that enables albumin binding and a 7-day half-life, allowing once-weekly dosing.

How does semaglutide work for weight loss?

Semaglutide activates GLP-1 receptors in the brain to reduce appetite and increase satiety, slows gastric emptying to promote fullness, and may influence food reward pathways. In STEP trials, participants lost 15-17% of body weight on average.

What are the most common semaglutide side effects?

The most common side effects are gastrointestinal: nausea (44%), diarrhea (30%), vomiting (24%), and constipation (24%). These typically occur during dose escalation and improve over time. Serious but rare risks include pancreatitis and gallbladder events.

What is the difference between Ozempic and Wegovy?

Ozempic and Wegovy both contain semaglutide but are approved for different indications. Ozempic (max 2 mg) is for type 2 diabetes, while Wegovy (max 2.4 mg) is for chronic weight management. Wegovy has a higher maximum dose and different dose escalation schedule.

Where to Find Semaglutide

Compare all vendor prices โ†’

Research-grade suppliers verified by our scoring methodology.

View all 57 vendors โ†’

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

Compare Semaglutide with Other Peptides

Semaglutide vs Amycretin

Amycretin shows potentially superior weight loss (up to 24.3% in Phase 1b/2a) compared to semaglutide (14.9% in STEP 1), driven by its dual GLP-1/amylin mechanism in a single molecule. The ability to offer both injectable and oral formulations without fasting restrictions is a significant advantage. However, these are early-phase results with small sample sizes and short duration. Semaglutide remains the proven, FDA-approved standard with cardiovascular benefit and extensive safety data. Amycretin is Novo Nordisk's most promising pipeline asset, but Phase 3 confirmation is needed before definitive comparisons can be made.

โ†’
Semaglutide vs Bioglutide

Bioglutide (NA-931) presents a novel quadruple-agonist mechanism that is scientifically ambitious, targeting GLP-1, GIP, glucagon, and IGF-1 receptors in a single oral molecule. The Phase 2 data (14.8% weight loss at 13 weeks with reported muscle preservation) are remarkable if confirmed, suggesting rapid, substantial weight loss that approaches semaglutide's 68-week results in just a fraction of the time. However, extreme caution is warranted. The data come from a small (125-patient), short (13-week) trial presented at conferences but not yet peer-reviewed in a major journal. The muscle preservation claims lack published DEXA data. Semaglutide remains the proven standard with massive evidence, cardiovascular benefit, and years of real-world safety data. Bioglutide's claims require rigorous Phase 3 validation before meaningful clinical comparison.

โ†’
Semaglutide vs BPC-157

These peptides serve entirely different purposes and are not interchangeable. Semaglutide is an FDA-approved pharmaceutical with massive clinical validation for diabetes and obesity. BPC-157 is a preclinical research peptide studied for tissue healing without any human clinical trials. The comparison highlights the enormous evidence gap between a fully validated drug and a promising preclinical compound. For metabolic disease, semaglutide has unequivocal evidence. For tissue healing research, BPC-157 has intriguing preclinical data that awaits human translation.

โ†’
Semaglutide vs CagriSema

CagriSema demonstrates meaningfully greater weight loss than semaglutide alone (20.4% vs 14.9%), driven by the complementary amylin pathway from cagrilintide. REDEFINE 1 showed CagriSema was superior to semaglutide alone, cagrilintide alone, and placebo. However, semaglutide has proven cardiovascular benefit (SELECT), 7+ years of safety data, oral formulation options, and established availability. CagriSema represents the next step for patients who need greater weight loss than semaglutide alone can provide, once it becomes available.

โ†’
Semaglutide vs Ecnoglutide

Ecnoglutide's biased GLP-1 signaling represents a scientifically novel approach, and SLIMMER Phase 3 data (15.4% weight loss at 48 weeks) are comparable to semaglutide's STEP 1 results (14.9% at 68 weeks). However, the comparison is limited by population differences (Chinese adults vs global populations), different trial durations, and vastly different evidence bases. Semaglutide has proven cardiovascular benefit, 7+ years of safety data, and global availability. Ecnoglutide may offer a competitive alternative in certain markets, particularly China, but its biased signaling advantage has not yet been demonstrated in head-to-head comparison with semaglutide.

โ†’
Semaglutide vs Exenatide

Semaglutide is substantially superior to exenatide in weight loss efficacy (14.9% vs 2-4%), glycemic control (SUSTAIN 3 head-to-head), cardiovascular outcomes (proven superiority vs non-inferiority only), and dosing convenience (pre-filled weekly pen vs reconstitution). Exenatide holds historical significance as the first GLP-1 agonist (FDA 2005) and may still serve as a lower-cost alternative in markets where newer agents are unavailable. However, for most clinical applications, semaglutide has effectively superseded exenatide.

โ†’
Semaglutide vs Liraglutide

Semaglutide is superior to liraglutide across every major clinical dimension. The STEP 8 head-to-head trial demonstrated nearly 2.5-fold greater weight loss with semaglutide (15.8% vs 6.4%) and a lower discontinuation rate (3.2% vs 12.6%). Semaglutide also offers once-weekly dosing (vs daily), broader cardiovascular evidence (SELECT trial in non-diabetic obesity), and both injectable and oral formulations. Liraglutide retains value as a lower-cost option with a longer safety track record, and it remains the only GLP-1 approved for adolescent obesity (ages 12+).

โ†’
Semaglutide vs MariTide

Semaglutide remains the proven standard with FDA approval, cardiovascular benefit, and the broadest evidence base of any GLP-1 agonist. MariTide offers a genuinely differentiated approach with three key innovations -- monthly dosing, an antibody-peptide conjugate platform, and GIP receptor antagonism (vs the GIP agonism used by tirzepatide). The phase 2 NEJM-published data showing up to 20% weight loss at 52 weeks with monthly injections and GI side effects concentrated at the first dose are particularly promising. If phase 3 confirms these results, MariTide could become the preferred option for patients who want the least frequent dosing schedule.

โ†’
Semaglutide vs Mazdutide

Semaglutide for proven efficacy with extensive safety data and global availability; mazdutide shows promise for potentially greater weight loss through dual agonism but requires broader clinical validation

โ†’
Semaglutide vs MET-097i

MET-097i represents a potentially disruptive approach to GLP-1 therapy with its ultra-long half-life enabling once-monthly dosing. Phase 2b data shows competitive weight loss (14.1% placebo-subtracted), and the convenience of monthly dosing could significantly improve treatment adherence. However, semaglutide remains the gold standard with proven efficacy, cardiovascular benefit, 7+ years of safety data, multiple formulations, and FDA approval. MET-097i's clinical value will ultimately depend on Phase 3 confirmation and whether the convenience advantage translates to better real-world outcomes. Pfizer's acquisition of Metsera signals strong commercial interest in the once-monthly GLP-1 concept.

โ†’
Semaglutide vs Orforglipron

Orforglipron represents a potential paradigm shift as the first oral non-peptide GLP-1 agonist without fasting restrictions, and it demonstrated superiority over oral semaglutide in the head-to-head ACHIEVE-3 trial for both HbA1c and weight loss. However, injectable semaglutide (2.4 mg) still produces greater absolute weight loss (14.9% vs 12.4%) and has proven cardiovascular benefit from SELECT, plus years of real-world safety data. The choice depends on whether oral convenience or maximum proven efficacy is the priority.

โ†’
Semaglutide vs Retatrutide

Semaglutide is the established gold standard with FDA approval, proven cardiovascular benefit, extensive clinical data, and multiple formulation options. Retatrutide's triple agonism shows promise for greater weight loss and liver fat reduction, but remains investigational with Phase 2 data only. Phase 3 results will determine whether retatrutide's early advantages translate into meaningful clinical superiority.

โ†’
Semaglutide vs Survodutide

Semaglutide is the established standard with three FDA approvals, massive clinical evidence, and proven cardiovascular outcomes. Survodutide represents the next-generation approach, adding glucagon receptor agonism to GLP-1 signaling for potentially greater weight loss and a unique MASH indication. However, survodutide remains in Phase 3 without regulatory approval. For current clinical use, semaglutide has unmatched validation. For the future of metabolic therapeutics, survodutide's dual mechanism targeting both caloric intake and energy expenditure could prove transformative if Phase 3 data confirm the Phase 2 promise.

โ†’
Semaglutide vs Tirzepatide

Tirzepatide demonstrates greater weight loss and glycemic control than semaglutide in clinical trials, achieving up to 20.9% body weight reduction versus 14.9-16.0% with semaglutide. However, semaglutide has proven cardiovascular benefit (SELECT trial), longer post-marketing safety data, and an oral formulation option. Both are FDA-approved, well-tolerated, and represent major advances in metabolic medicine. The choice between them depends on clinical priorities: maximum weight loss favors tirzepatide, while cardiovascular risk reduction and formulation flexibility favor semaglutide.

โ†’
Semaglutide vs VK2735

Semaglutide is the clear choice for patients who need treatment today, with FDA approval, proven cardiovascular benefit, and over 7 years of safety data. VK2735 shows promising early results, with rapid weight loss in short-term phase 2 trials that suggest it could be competitive with established agents. Its dual GLP-1/GIP mechanism and development of both injectable and oral formulations position it as a potential future competitor, but it remains years from potential approval and lacks long-term efficacy and safety data.

โ†’
Semaglutide vs Zovaglutide

Semaglutide is the proven standard with extensive Phase 3, real-world, and cardiovascular outcomes data across tens of thousands of patients. Zovaglutide offers the compelling advantage of once-monthly dosing (12-13 injections per year vs 52) with early Phase 2 data showing competitive weight loss and low GI side effect rates. However, zovaglutide has only 303 patients studied over 24 weeks, no Phase 3 data, and no long-term safety information. For current treatment decisions, semaglutide is the clear choice. Zovaglutide represents an important advance in dosing convenience if Phase 3 confirms the Phase 2 results.

โ†’

Related Articles

You Might Also Like

Related content you may find interesting