Skip to main content

GLP-1

Also known as: Glucagon-Like Peptide-1, Incretin, GLP-1(7-36)amide, GLP-1(7-37)

Research compiled by Peptide Protocol Wiki
๐Ÿ“…Updated February 9, 2026
Citations Verified
New to metabolic peptides?Browse all metabolic peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขFoundation for blockbuster GLP-1 receptor agonist drug class (semaglutide, liraglutide, tirzepatide)
  • โ€ขGlucose-dependent insulin secretion reduces hypoglycemia risk
  • โ€ขPromotes significant weight loss (up to 15-22% in clinical trials)
  • โ€ขCardiovascular risk reduction demonstrated in major outcomes trials
  • โ€ขExpanding therapeutic applications in NASH, heart failure, and neurodegeneration

Community-Reported Side EffectsAnecdotal?

Protocol Quick-Reference

Weight management and type 2 diabetes treatment via GLP-1 receptor agonism

Dosing

Amount

Semaglutide: 0.25 mg escalating to 2.4 mg weekly (obesity); Tirzepatide: 2.5 mg escalating to 15 mg weekly

Frequency

Once weekly (semaglutide, tirzepatide) or once daily (liraglutide)

Duration

Chronic therapy (ongoing); weight regain common upon discontinuation

Step-wise Titration (16 weeks)

Administration

Route

SC

Schedule

Once weekly (semaglutide, tirzepatide) or once daily (liraglutide)

Timing

Any time of day, with or without meals; same day each week for weekly agents

โœ“ Rotate injection sites

Cycle

Duration

Chronic therapy (ongoing); weight regain common upon discontinuation

Repeatable

Yes

Preparation & Storage

โœ“ Ready-to-use โ€” no reconstitution required

Storage: Pre-filled pens: Store refrigerated at 2-8 degrees C before first use. After first use, may be stored at room temperature (up to 30 degrees C) for the product-specific in-use period (14-56 days depending on product). Do not freeze.

โš—๏ธ Suggested Bloodwork (6 tests)

HbA1c and fasting glucose

When: Baseline

Why: Baseline glycemic status

Comprehensive metabolic panel (CMP)

When: Baseline

Why: Renal and hepatic function baseline

Lipid panel

When: Baseline

Why: Baseline cardiovascular risk markers

TSH

When: Baseline

Why: Thyroid function baseline (thyroid C-cell concerns in animal studies)

Lipase and amylase

When: Baseline

Why: Baseline pancreatic enzymes

HbA1c

When: 3 months

Why: Assess glycemic improvement

๐Ÿ’ก Key Considerations
  • โ†’Oral semaglutide (Rybelsus) must be taken on empty stomach with no more than 4 oz plain water, 30 min before food
  • โ†’Contraindication: Contraindicated in personal or family history of medullary thyroid carcinoma or MEN2 syndrome

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates โ€” free.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for GLP-1
How GLP-1 works at the cellular level
Key benefits and uses of GLP-1
Overview of GLP-1 benefits and applications
Scientific Details
Molecular Formula
C149H225N39O45
Molecular Weight
3297.7 (active form, GLP-1(7-36)amide) Da
CAS Number
87805-34-3
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

What Is GLP-1?#

Glucagon-like peptide-1 (GLP-1) is a 30-amino-acid incretin hormone produced by intestinal L-cells in response to nutrient ingestion. It plays a central role in glucose homeostasis by stimulating insulin secretion in a glucose-dependent manner, suppressing inappropriate glucagon release, slowing gastric emptying, and promoting satiety. The discovery and therapeutic exploitation of GLP-1 biology has led to one of the most important classes of drugs developed in the 21st century: the GLP-1 receptor agonists (GLP-1 RAs), which have transformed the treatment of type 2 diabetes and obesity.

The active forms of GLP-1 are GLP-1(7-36)amide and GLP-1(7-37), both cleaved from the proglucagon precursor protein. In the circulation, native GLP-1 is rapidly inactivated by the enzyme dipeptidyl peptidase-4 (DPP-4), giving it a plasma half-life of only 1-2 minutes. This rapid degradation has driven the development of DPP-4 resistant GLP-1 analogs and long-acting formulations that maintain GLP-1 receptor activation for hours, days, or even weeks.

Mechanism of Action#

GLP-1 exerts its effects by binding to the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor expressed on pancreatic beta cells, the gastrointestinal tract, the central nervous system, the heart, and other tissues. Key actions include:

  1. Insulin secretion: GLP-1 potentiates glucose-stimulated insulin secretion from pancreatic beta cells. Crucially, this effect is glucose-dependent, meaning it operates only when blood glucose is elevated, greatly reducing the risk of hypoglycemia compared to insulin or sulfonylureas.

  2. Glucagon suppression: GLP-1 suppresses inappropriate postprandial glucagon secretion from pancreatic alpha cells, reducing hepatic glucose output.

  3. Gastric emptying: GLP-1 slows the rate of gastric emptying, reducing the rate of glucose absorption and contributing to postprandial glucose control.

  4. Satiety and appetite reduction: GLP-1 receptors in the hypothalamus and brainstem mediate appetite suppression and promote a feeling of fullness. This effect is a major contributor to the weight loss observed with GLP-1 receptor agonists.

  5. Beta cell preservation: In preclinical models, GLP-1 promotes beta cell proliferation and inhibits apoptosis, though the clinical relevance of these effects in humans is still being investigated.

The Incretin Effect#

GLP-1 was identified through the study of the "incretin effect" โ€” the observation that oral glucose produces a greater insulin response than intravenous glucose at the same blood glucose levels. This difference is attributed to gut-derived hormones, primarily GLP-1 and glucose-dependent insulinotropic polypeptide (GIP), which are released from intestinal cells during meal absorption and amplify the pancreatic insulin response. In type 2 diabetes, the incretin effect is substantially diminished, providing a rational basis for GLP-1-based therapies.

GLP-1 Receptor Agonists#

The rapid degradation of native GLP-1 by DPP-4 necessitated the development of resistant analogs for therapeutic use. Major approved GLP-1 receptor agonists include:

  • Exenatide (Byetta/Bydureon): First-in-class, based on exendin-4 from Gila monster venom; twice-daily or weekly formulations
  • Liraglutide (Victoza/Saxenda): Acylated GLP-1 analog with albumin binding; once-daily injection for diabetes (Victoza) or obesity (Saxenda)
  • Semaglutide (Ozempic/Wegovy/Rybelsus): Long-acting GLP-1 analog; weekly injection (Ozempic/Wegovy) or oral tablet (Rybelsus)
  • Dulaglutide (Trulicity): GLP-1-Fc fusion protein; weekly injection
  • Tirzepatide (Mounjaro/Zepbound): Dual GIP/GLP-1 receptor agonist; weekly injection representing the next generation

These drugs have demonstrated robust efficacy in reducing HbA1c (1-2% reductions), promoting weight loss (5-20% of body weight depending on agent and dose), and in some cases reducing cardiovascular events.

Clinical Impact#

GLP-1 receptor agonists represent one of the largest therapeutic advances in endocrinology. Major clinical milestones include:

  • Cardiovascular benefit: The LEADER trial (liraglutide) and SUSTAIN-6 trial (semaglutide) demonstrated reduced cardiovascular events in patients with type 2 diabetes at high cardiovascular risk
  • Obesity treatment: Semaglutide 2.4 mg weekly (Wegovy) produced mean weight loss of approximately 15% in the STEP trials, transforming the obesity treatment landscape
  • Oral GLP-1 agonist: Oral semaglutide (Rybelsus) achieved the previously thought impossible โ€” oral delivery of a peptide drug with clinically meaningful bioavailability
  • Dual agonism: Tirzepatide's dual GIP/GLP-1 agonism has shown even greater weight loss (up to 22.5% in clinical trials), opening new therapeutic frontiers

Beyond Diabetes and Obesity#

Research is expanding the potential applications of GLP-1 receptor agonists to include nonalcoholic steatohepatitis (NASH/MASH), heart failure with preserved ejection fraction, chronic kidney disease, and potentially neurodegenerative conditions including Alzheimer's disease. The breadth of GLP-1 receptor expression throughout the body suggests that its therapeutic potential extends well beyond metabolic disease.

Key Research Findings#

Glucagon-like peptide 1 promotes satiety and suppresses energy intake in humans, published in Journal of Clinical Investigation (Flint A et al., 1998; PMID: 9449682):

  • GLP-1 infusion reduced ad libitum food intake by 12%

Liraglutide and Cardiovascular Outcomes in Type 2 Diabetes (LEADER), published in New England Journal of Medicine (Marso SP et al., 2016; PMID: 27295427):

  • The study demonstrated reduction of 13% in MACE (major adverse cardiovascular events)

Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP 1), published in New England Journal of Medicine (Wilding JPH et al., 2021; PMID: 33567185):

  • The study showed mean weight loss of 14.9% vs 2.4% placebo
  • The study demonstrated achieved of 86.4% at least 5% weight loss

Tirzepatide Once Weekly for the Treatment of Obesity (SURMOUNT-1), published in New England Journal of Medicine (Jastreboff AM et al., 2022; PMID: 35658024):

  • The study showed mean weight loss of 20.9% at 72 weeks
  • The study demonstrated of participants on 15 mg achieved of 63% at least 20% weight loss

Stay current on GLP-1 research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 100+ community reports

View community protocols

Frequently Asked Questions About GLP-1

What is GLP-1?

GLP-1 (Glucagon-Like Peptide-1) is a 30-amino-acid incretin hormone produced by intestinal L-cells that stimulates glucose-dependent insulin secretion, suppresses glucagon, slows gastric emptying, and promotes satiety. GLP-1 receptor agonists such as semaglutide and tirzepatide have transformed the treatment of type 2 diabetes and obesity.

What are the benefits of GLP-1?

Research suggests the following potential benefits of GLP-1: Foundation for blockbuster GLP-1 receptor agonist drug class (semaglutide, liraglutide, tirzepatide). Glucose-dependent insulin secretion reduces hypoglycemia risk. Promotes significant weight loss (up to 15-22% in clinical trials). Cardiovascular risk reduction demonstrated in major outcomes trials. Expanding therapeutic applications in NASH, heart failure, and neurodegeneration. These findings are based on available studies and the evidence level varies across different applications.

What are the side effects of GLP-1?

Reported side effects of GLP-1 include vomiting, diarrhea, constipation, injection site reactions. Most reported side effects are mild and transient. Comprehensive human safety data may be limited. Consult the detailed side effects profile for full information.

Is GLP-1 FDA approved?

GLP-1 is currently in the approved stage. In the United States, it is classified as approved. Multiple GLP-1 RAs FDA-approved for type 2 diabetes (Ozempic, Victoza, Trulicity) and obesity (Wegovy, Saxenda, Zepbound) Regulations vary by country and may change.

Research protocols for GLP-1 typically use 0.25 mg to 2.0 mg weekly administered Once weekly subcutaneous for Chronic therapy. Start 0.25 mg x 4 weeks, then 0.5 mg; may increase to 1.0 mg then 2.0 mg. No standardized human dosing has been established by regulatory bodies.

Research-grade suppliers verified by our scoring methodology.

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting