Skip to main content

GLP-1

Also known as: Glucagon-Like Peptide-1, Incretin, GLP-1(7-36)amide, GLP-1(7-37)

Research compiled by Peptide Protocol Wiki
๐Ÿ“…Updated February 9, 2026
Citations Verified
New to metabolic peptides?Browse all metabolic peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขFoundation for blockbuster GLP-1 receptor agonist drug class (semaglutide, liraglutide, tirzepatide)
  • โ€ขGlucose-dependent insulin secretion reduces hypoglycemia risk
  • โ€ขPromotes significant weight loss (up to 15-22% in clinical trials)
  • โ€ขCardiovascular risk reduction demonstrated in major outcomes trials
  • โ€ขExpanding therapeutic applications in NASH, heart failure, and neurodegeneration

Community-Reported Side EffectsAnecdotal?

Protocol Quick-Reference

Weight management and type 2 diabetes treatment via GLP-1 receptor agonism

Dosing

Amount

Semaglutide: 0.25 mg escalating to 2.4 mg weekly (obesity); Tirzepatide: 2.5 mg escalating to 15 mg weekly

Frequency

Once weekly (semaglutide, tirzepatide) or once daily (liraglutide)

Duration

Chronic therapy (ongoing); weight regain common upon discontinuation

Step-wise Titration (16 weeks)

Administration

Route

SC

Schedule

Once weekly (semaglutide, tirzepatide) or once daily (liraglutide)

Timing

Any time of day, with or without meals; same day each week for weekly agents

โœ“ Rotate injection sites

Cycle

Duration

Chronic therapy (ongoing); weight regain common upon discontinuation

Repeatable

Yes

Preparation & Storage

โœ“ Ready-to-use โ€” no reconstitution required

Storage: Pre-filled pens: Store refrigerated at 2-8 degrees C before first use. After first use, may be stored at room temperature (up to 30 degrees C) for the product-specific in-use period (14-56 days depending on product). Do not freeze.

โš—๏ธ Suggested Bloodwork (6 tests)

HbA1c and fasting glucose

When: Baseline

Why: Baseline glycemic status

Comprehensive metabolic panel (CMP)

When: Baseline

Why: Renal and hepatic function baseline

Lipid panel

When: Baseline

Why: Baseline cardiovascular risk markers

TSH

When: Baseline

Why: Thyroid function baseline (thyroid C-cell concerns in animal studies)

Lipase and amylase

When: Baseline

Why: Baseline pancreatic enzymes

HbA1c

When: 3 months

Why: Assess glycemic improvement

๐Ÿ’ก Key Considerations
  • โ†’Oral semaglutide (Rybelsus) must be taken on empty stomach with no more than 4 oz plain water, 30 min before food
  • โ†’Contraindication: Contraindicated in personal or family history of medullary thyroid carcinoma or MEN2 syndrome

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates โ€” free.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for GLP-1
How GLP-1 works at the cellular level
Key benefits and uses of GLP-1
Overview of GLP-1 benefits and applications
Scientific Details
Molecular Formula
C149H225N39O45
Molecular Weight
3297.7 (active form, GLP-1(7-36)amide) Da
CAS Number
87805-34-3
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

What Is GLP-1?#

Glucagon-like peptide-1 (GLP-1) is a 30-amino-acid incretin hormone produced by intestinal L-cells in response to nutrient ingestion. It plays a central role in glucose homeostasis by stimulating insulin secretion in a glucose-dependent manner, suppressing inappropriate glucagon release, slowing gastric emptying, and promoting satiety. The discovery and therapeutic exploitation of GLP-1 biology has led to one of the most important classes of drugs developed in the 21st century: the GLP-1 receptor agonists (GLP-1 RAs), which have transformed the treatment of type 2 diabetes and obesity.

The active forms of GLP-1 are GLP-1(7-36)amide and GLP-1(7-37), both cleaved from the proglucagon precursor protein. In the circulation, native GLP-1 is rapidly inactivated by the enzyme dipeptidyl peptidase-4 (DPP-4), giving it a plasma half-life of only 1-2 minutes. This rapid degradation has driven the development of DPP-4 resistant GLP-1 analogs and long-acting formulations that maintain GLP-1 receptor activation for hours, days, or even weeks.

Mechanism of Action#

GLP-1 exerts its effects by binding to the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor expressed on pancreatic beta cells, the gastrointestinal tract, the central nervous system, the heart, and other tissues. Key actions include:

  1. Insulin secretion: GLP-1 potentiates glucose-stimulated insulin secretion from pancreatic beta cells. Crucially, this effect is glucose-dependent, meaning it operates only when blood glucose is elevated, greatly reducing the risk of hypoglycemia compared to insulin or sulfonylureas.

  2. Glucagon suppression: GLP-1 suppresses inappropriate postprandial glucagon secretion from pancreatic alpha cells, reducing hepatic glucose output.

  3. Gastric emptying: GLP-1 slows the rate of gastric emptying, reducing the rate of glucose absorption and contributing to postprandial glucose control.

  4. Satiety and appetite reduction: GLP-1 receptors in the hypothalamus and brainstem mediate appetite suppression and promote a feeling of fullness. This effect is a major contributor to the weight loss observed with GLP-1 receptor agonists.

  5. Beta cell preservation: In preclinical models, GLP-1 promotes beta cell proliferation and inhibits apoptosis, though the clinical relevance of these effects in humans is still being investigated.

The Incretin Effect#

GLP-1 was identified through the study of the "incretin effect" โ€” the observation that oral glucose produces a greater insulin response than intravenous glucose at the same blood glucose levels. This difference is attributed to gut-derived hormones, primarily GLP-1 and glucose-dependent insulinotropic polypeptide (GIP), which are released from intestinal cells during meal absorption and amplify the pancreatic insulin response. In type 2 diabetes, the incretin effect is substantially diminished, providing a rational basis for GLP-1-based therapies.

GLP-1 Receptor Agonists#

The rapid degradation of native GLP-1 by DPP-4 necessitated the development of resistant analogs for therapeutic use. Major approved GLP-1 receptor agonists include:

  • Exenatide (Byetta/Bydureon): First-in-class, based on exendin-4 from Gila monster venom; twice-daily or weekly formulations
  • Liraglutide (Victoza/Saxenda): Acylated GLP-1 analog with albumin binding; once-daily injection for diabetes (Victoza) or obesity (Saxenda)
  • Semaglutide (Ozempic/Wegovy/Rybelsus): Long-acting GLP-1 analog; weekly injection (Ozempic/Wegovy) or oral tablet (Rybelsus)
  • Dulaglutide (Trulicity): GLP-1-Fc fusion protein; weekly injection
  • Tirzepatide (Mounjaro/Zepbound): Dual GIP/GLP-1 receptor agonist; weekly injection representing the next generation

These drugs have demonstrated robust efficacy in reducing HbA1c (1-2% reductions), promoting weight loss (5-20% of body weight depending on agent and dose), and in some cases reducing cardiovascular events.

Clinical Impact#

GLP-1 receptor agonists represent one of the largest therapeutic advances in endocrinology. Major clinical milestones include:

  • Cardiovascular benefit: The LEADER trial (liraglutide) and SUSTAIN-6 trial (semaglutide) demonstrated reduced cardiovascular events in patients with type 2 diabetes at high cardiovascular risk
  • Obesity treatment: Semaglutide 2.4 mg weekly (Wegovy) produced mean weight loss of approximately 15% in the STEP trials, transforming the obesity treatment landscape
  • Oral GLP-1 agonist: Oral semaglutide (Rybelsus) achieved the previously thought impossible โ€” oral delivery of a peptide drug with clinically meaningful bioavailability
  • Dual agonism: Tirzepatide's dual GIP/GLP-1 agonism has shown even greater weight loss (up to 22.5% in clinical trials), opening new therapeutic frontiers

Beyond Diabetes and Obesity#

Research is expanding the potential applications of GLP-1 receptor agonists to include nonalcoholic steatohepatitis (NASH/MASH), heart failure with preserved ejection fraction, chronic kidney disease, and potentially neurodegenerative conditions including Alzheimer's disease. The breadth of GLP-1 receptor expression throughout the body suggests that its therapeutic potential extends well beyond metabolic disease.

Key Research Findings#

Glucagon-like peptide 1 promotes satiety and suppresses energy intake in humans, published in Journal of Clinical Investigation (Flint A et al., 1998; PMID: 9449682):

  • GLP-1 infusion reduced ad libitum food intake by 12%

Liraglutide and Cardiovascular Outcomes in Type 2 Diabetes (LEADER), published in New England Journal of Medicine (Marso SP et al., 2016; PMID: 27295427):

  • The study demonstrated reduction of 13% in MACE (major adverse cardiovascular events)

Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP 1), published in New England Journal of Medicine (Wilding JPH et al., 2021; PMID: 33567185):

  • The study showed mean weight loss of 14.9% vs 2.4% placebo
  • The study demonstrated achieved of 86.4% at least 5% weight loss

Tirzepatide Once Weekly for the Treatment of Obesity (SURMOUNT-1), published in New England Journal of Medicine (Jastreboff AM et al., 2022; PMID: 35658024):

  • The study showed mean weight loss of 20.9% at 72 weeks
  • The study demonstrated of participants on 15 mg achieved of 63% at least 20% weight loss

Stay current on GLP-1 research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 100+ community reports

View community protocols

Frequently Asked Questions About GLP-1

Research-grade suppliers verified by our scoring methodology.

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting