Exenatide
Also known as: Byetta, Bydureon, exendin-4, AC2993
๐TL;DR
- โขHistoric significance: first GLP-1 receptor agonist ever approved (2005)
- โขBoth twice-daily (Byetta) and once-weekly (Bydureon BCise) formulations
- โขCardiovascular safety demonstrated in EXSCEL trial (14,752 patients)
- โขGlucose-dependent insulin secretion reduces hypoglycemia risk
- โขUnique molecular origin from Gila monster venom (exendin-4)
- โขActive investigation for neuroprotective effects in Parkinson's disease
Community-Reported Side EffectsAnecdotal?
Protocol Quick-Reference
Type 2 diabetes glycemic control
Dosing
Amount
5-10 mcg BID (Byetta) or 2 mg weekly (Bydureon BCise)
Frequency
Twice daily (Byetta) or once weekly (Bydureon BCise)
Duration
Ongoing (chronic therapy)
Step-wise Titration (4 weeks)
Administration
Route
SCSchedule
Twice daily (Byetta) or once weekly (Bydureon BCise)
Timing
Byetta: within 60 minutes before meals; Bydureon BCise: any time, any day
โ Rotate injection sites
Cycle
Duration
Ongoing (chronic therapy)
Repeatable
Yes
Preparation & Storage
โ Ready-to-use โ no reconstitution required
Storage: Byetta: refrigerate or room temp up to 30 days after first use. Bydureon BCise: refrigerate or room temp up to 4 weeks.
โ๏ธ Suggested Bloodwork (6 tests)
HbA1c and fasting glucose
When: Baseline
Why: Baseline glycemic control
Lipid panel
When: Baseline
Why: Baseline cardiovascular markers
CMP with renal function
When: Baseline
Why: Kidney function (renal elimination)
Thyroid panel (TSH, free T4)
When: Baseline
Why: Rule out thyroid disorders (black box MTC warning)
Amylase and lipase
When: Baseline
Why: Baseline pancreatic function
HbA1c
When: 12 weeks
Why: Monitor glycemic improvement
๐ก Key Considerations
- โByetta requires meal timing: inject within 60 minutes before meals
- โBydureon BCise: shake vigorously for 15 seconds before injection
- โContraindication: Avoid with personal/family history of medullary thyroid carcinoma or MEN2 syndrome
Subscribe to unlock this content
Get weekly peptide research summaries, new study alerts, and protocol updates โ free.
150+ peptide profiles ยท 30+ comparisons ยท 18 research tools


Scientific Details
- Molecular Formula
- C184H282N50O60S
- Molecular Weight
- 4186.6 Da
- CAS Number
- 141758-74-9
- Sequence
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
What is Exenatide?#
Exenatide is a 39-amino-acid peptide that is the synthetic form of exendin-4, a naturally occurring peptide discovered in 1990 by Dr. John Eng in the saliva of the Gila monster lizard (Heloderma suspectum). Exendin-4 shares approximately 53% amino acid sequence homology with human glucagon-like peptide-1 (GLP-1) and functions as a potent GLP-1 receptor agonist.
Exenatide holds watershed significance in pharmacology as the first GLP-1 receptor agonist approved by the FDA, launching the entire incretin mimetic drug class that now includes semaglutide, liraglutide, tirzepatide, and many others. It is marketed under two brand names:
- Byetta (immediate-release): FDA-approved April 28, 2005 as the first GLP-1 RA for type 2 diabetes, administered as a twice-daily subcutaneous injection (5 or 10 mcg) within 60 minutes before the two largest meals
- Bydureon BCise (extended-release): FDA-approved January 2012 (original Bydureon) as a once-weekly subcutaneous injection (2 mg) using a poly(D,L-lactide-co-glycolide) (PLG) microsphere formulation for sustained release
Discovery History#
The discovery of exenatide illustrates how basic research in unexpected places can yield transformative medicines. Dr. John Eng, an endocrinologist at the VA Medical Center in the Bronx, New York, investigated Gila monster venom after learning that the lizard can survive long periods without eating while maintaining stable blood glucose. He isolated exendin-4 from the venom and demonstrated that it stimulated insulin secretion from pancreatic beta-cells in a glucose-dependent manner.
Amylin Pharmaceuticals subsequently developed synthetic exendin-4 (designated AC2993, later named exenatide) through clinical trials, partnering with Eli Lilly for commercialization. In 2012, Dr. Eng was co-awarded the Golden Goose Award by the U.S. Congress, recognizing seemingly unconventional research that led to major public benefit.
Mechanism of Action#
Exenatide activates the GLP-1 receptor, mimicking and extending the effects of the endogenous incretin hormone GLP-1. Despite only 53% sequence homology with human GLP-1, exenatide binds to and activates the GLP-1 receptor with comparable potency.
Incretin Effects#
- Glucose-dependent insulin secretion: Stimulates pancreatic beta-cells to release insulin only when blood glucose is elevated, substantially reducing hypoglycemia risk compared to insulin or sulfonylureas
- Glucagon suppression: Inhibits inappropriate glucagon secretion from alpha-cells in the hyperglycemic state
- Gastric emptying delay: Slows gastric emptying, particularly prominent with the immediate-release (Byetta) formulation, reducing postprandial glucose excursions
- Central appetite effects: Acts on GLP-1 receptors in the hypothalamus and brainstem to modestly reduce appetite
Key Pharmacological Differences from Human GLP-1 Analogs#
Unlike liraglutide and semaglutide, which are modified versions of the human GLP-1(7-37) peptide, exenatide is an entirely different peptide sequence derived from a reptilian source. The key advantage of this natural exendin-4 sequence is inherent resistance to DPP-4 enzymatic degradation (the enzyme that rapidly inactivates native GLP-1), without needing the artificial modifications (e.g., Aib substitutions) used in human GLP-1 analogs.
Research Overview#
Exenatide's evidence base spans the AMIGO phase 3 trials (twice-daily), DURATION trials (once-weekly), and the large EXSCEL cardiovascular outcomes trial (14,752 patients). While superseded by newer GLP-1 agonists for glycemic efficacy, exenatide maintains unique research interest for potential neuroprotective applications in Parkinson's disease.
Important Considerations#
- Prescription medication requiring medical supervision
- Contraindicated in patients with personal or family history of medullary thyroid carcinoma or MEN2
- Most common adverse events are gastrointestinal (nausea, vomiting)
- Byetta must be injected within 60 minutes before meals; Bydureon BCise is independent of meals
- Higher anti-drug antibody formation compared to human GLP-1 analogs due to non-human sequence
- Injection site nodules common with Bydureon microsphere formulation
Key Research Findings#
Effects of Once-Weekly Exenatide on Cardiovascular Outcomes in Type 2 Diabetes (EXSCEL), published in New England Journal of Medicine (Holman RR et al., 2017; PMID: 28910237):
- The study showed all cause mortality nominally reduced by 14% but not prespecified
Related Reading#
Stay current on Exenatide research
We summarize new studies, safety updates, and dosing insights โ delivered biweekly.
Community Protocols Available
See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.
Based on 30+ community reports
View community protocolsFrequently Asked Questions About Exenatide
Explore Further
Related Peptides
View all peptides โSemaglutide
Semaglutide: FDA-approved GLP-1 agonist for weight loss and diabetes. Covers STEP/SUSTAIN trials, Ozempic vs Wegovy dosing, and cardiovascular benefits.
Liraglutide
Liraglutide: FDA-approved GLP-1 receptor agonist for type 2 diabetes and weight management. Covers LEADER cardiovascular trial, SCALE weight loss data, and Victoza/Saxenda dosing.
Tirzepatide
Tirzepatide: FDA-approved dual GIP/GLP-1 agonist with up to 22.5% weight loss. Covers SURPASS/SURMOUNT trials, dosing, and semaglutide comparison.
GLP-1
GLP-1: Incretin hormone powering modern weight loss drugs. Covers insulin secretion, satiety signaling, semaglutide and liraglutide data, and safety.
Medical Disclaimer
This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.
Compare Exenatide with Other Peptides
Liraglutide is superior to exenatide across all major clinical dimensions. The LEAD-6 head-to-head trial demonstrated greater HbA1c reduction (1.12% vs 0.79%), fewer hypoglycemia events, and better tolerability. Liraglutide also has an FDA-approved obesity indication (Saxenda, 8.0% weight loss in SCALE), proven cardiovascular benefit (LEADER, 13% MACE reduction), and once-daily dosing without microsphere-related injection site reactions. Exenatide retains historical significance as the first GLP-1 agonist and may serve as a lower-cost option in resource-limited settings, but liraglutide is the preferred agent for new prescriptions among these two options.
Semaglutide is substantially superior to exenatide in weight loss efficacy (14.9% vs 2-4%), glycemic control (SUSTAIN 3 head-to-head), cardiovascular outcomes (proven superiority vs non-inferiority only), and dosing convenience (pre-filled weekly pen vs reconstitution). Exenatide holds historical significance as the first GLP-1 agonist (FDA 2005) and may still serve as a lower-cost alternative in markets where newer agents are unavailable. However, for most clinical applications, semaglutide has effectively superseded exenatide.
You Might Also Like
Related content you may find interesting