Skip to main content
๐ŸงฌPeptide Protocol Wiki

Exenatide

Also known as: Byetta, Bydureon, exendin-4, AC2993

โœ“Reviewed byDr. Research Team(MD (composite credential representing medical review team), PhD in Pharmacology)
๐Ÿ“…Updated February 12, 2026
Verified by Dr. Research Team on February 12, 2026
New to metabolic peptides?Browse all metabolic peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขHistoric significance: first GLP-1 receptor agonist ever approved (2005)
  • โ€ขBoth twice-daily (Byetta) and once-weekly (Bydureon BCise) formulations
  • โ€ขCardiovascular safety demonstrated in EXSCEL trial (14,752 patients)
  • โ€ขGlucose-dependent insulin secretion reduces hypoglycemia risk
  • โ€ขUnique molecular origin from Gila monster venom (exendin-4)
  • โ€ขActive investigation for neuroprotective effects in Parkinson's disease
0:000:00

Protocol Quick-Reference

Type 2 diabetes glycemic control

Dosing

Amount

5-10 mcg BID (Byetta) or 2 mg weekly (Bydureon BCise)

Frequency

Twice daily (Byetta) or once weekly (Bydureon BCise)

Duration

Ongoing (chronic therapy)

Step-wise Titration (4 weeks)

Administration

Route

SC

Schedule

Twice daily (Byetta) or once weekly (Bydureon BCise)

Timing

Byetta: within 60 minutes before meals; Bydureon BCise: any time, any day

โœ“ Rotate injection sites

Cycle

Duration

Ongoing (chronic therapy)

Repeatable

Yes

Preparation & Storage

โœ“ Ready-to-use โ€” no reconstitution required

Storage: Byetta: refrigerate or room temp up to 30 days after first use. Bydureon BCise: refrigerate or room temp up to 4 weeks.

โš—๏ธ Suggested Bloodwork (6 tests)

HbA1c and fasting glucose

When: Baseline

Why: Baseline glycemic control

Lipid panel

When: Baseline

Why: Baseline cardiovascular markers

CMP with renal function

When: Baseline

Why: Kidney function (renal elimination)

Thyroid panel (TSH, free T4)

When: Baseline

Why: Rule out thyroid disorders (black box MTC warning)

Amylase and lipase

When: Baseline

Why: Baseline pancreatic function

HbA1c

When: 12 weeks

Why: Monitor glycemic improvement

๐Ÿ’ก Key Considerations
  • โ†’Byetta requires meal timing: inject within 60 minutes before meals
  • โ†’Bydureon BCise: shake vigorously for 15 seconds before injection
  • โ†’Contraindication: Avoid with personal/family history of medullary thyroid carcinoma or MEN2 syndrome

Subscribe to unlock this content

Get free access to all content plus biweekly research updates.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for Exenatide
How Exenatide works at the cellular level
Key benefits and uses of Exenatide
Overview of Exenatide benefits and applications
Scientific Details
Molecular Formula
C184H282N50O60S
Molecular Weight
4186.6 Da
CAS Number
141758-74-9
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

What is Exenatide?#

Exenatide is a 39-amino-acid peptide that is the synthetic form of exendin-4, a naturally occurring peptide discovered in 1990 by Dr. John Eng in the saliva of the Gila monster lizard (Heloderma suspectum). Exendin-4 shares approximately 53% amino acid sequence homology with human glucagon-like peptide-1 (GLP-1) and functions as a potent GLP-1 receptor agonist.

Exenatide holds watershed significance in pharmacology as the first GLP-1 receptor agonist approved by the FDA, launching the entire incretin mimetic drug class that now includes semaglutide, liraglutide, tirzepatide, and many others. It is marketed under two brand names:

  • Byetta (immediate-release): FDA-approved April 28, 2005 as the first GLP-1 RA for type 2 diabetes, administered as a twice-daily subcutaneous injection (5 or 10 mcg) within 60 minutes before the two largest meals
  • Bydureon BCise (extended-release): FDA-approved January 2012 (original Bydureon) as a once-weekly subcutaneous injection (2 mg) using a poly(D,L-lactide-co-glycolide) (PLG) microsphere formulation for sustained release

Discovery History#

The discovery of exenatide illustrates how basic research in unexpected places can yield transformative medicines. Dr. John Eng, an endocrinologist at the VA Medical Center in the Bronx, New York, investigated Gila monster venom after learning that the lizard can survive long periods without eating while maintaining stable blood glucose. He isolated exendin-4 from the venom and demonstrated that it stimulated insulin secretion from pancreatic beta-cells in a glucose-dependent manner.

Amylin Pharmaceuticals subsequently developed synthetic exendin-4 (designated AC2993, later named exenatide) through clinical trials, partnering with Eli Lilly for commercialization. In 2012, Dr. Eng was co-awarded the Golden Goose Award by the U.S. Congress, recognizing seemingly unconventional research that led to major public benefit.

Mechanism of Action#

Exenatide activates the GLP-1 receptor, mimicking and extending the effects of the endogenous incretin hormone GLP-1. Despite only 53% sequence homology with human GLP-1, exenatide binds to and activates the GLP-1 receptor with comparable potency.

Incretin Effects#

  • Glucose-dependent insulin secretion: Stimulates pancreatic beta-cells to release insulin only when blood glucose is elevated, substantially reducing hypoglycemia risk compared to insulin or sulfonylureas
  • Glucagon suppression: Inhibits inappropriate glucagon secretion from alpha-cells in the hyperglycemic state
  • Gastric emptying delay: Slows gastric emptying, particularly prominent with the immediate-release (Byetta) formulation, reducing postprandial glucose excursions
  • Central appetite effects: Acts on GLP-1 receptors in the hypothalamus and brainstem to modestly reduce appetite

Key Pharmacological Differences from Human GLP-1 Analogs#

Unlike liraglutide and semaglutide, which are modified versions of the human GLP-1(7-37) peptide, exenatide is an entirely different peptide sequence derived from a reptilian source. The key advantage of this natural exendin-4 sequence is inherent resistance to DPP-4 enzymatic degradation (the enzyme that rapidly inactivates native GLP-1), without needing the artificial modifications (e.g., Aib substitutions) used in human GLP-1 analogs.

Research Overview#

Exenatide's evidence base spans the AMIGO phase 3 trials (twice-daily), DURATION trials (once-weekly), and the large EXSCEL cardiovascular outcomes trial (14,752 patients). While superseded by newer GLP-1 agonists for glycemic efficacy, exenatide maintains unique research interest for potential neuroprotective applications in Parkinson's disease.

Important Considerations#

  • Prescription medication requiring medical supervision
  • Contraindicated in patients with personal or family history of medullary thyroid carcinoma or MEN2
  • Most common adverse events are gastrointestinal (nausea, vomiting)
  • Byetta must be injected within 60 minutes before meals; Bydureon BCise is independent of meals
  • Higher anti-drug antibody formation compared to human GLP-1 analogs due to non-human sequence
  • Injection site nodules common with Bydureon microsphere formulation

Key Research Findings#

Effects of Once-Weekly Exenatide on Cardiovascular Outcomes in Type 2 Diabetes (EXSCEL), published in New England Journal of Medicine (Holman RR et al., 2017; PMID: 28910237):

  • The study showed all cause mortality nominally reduced by 14% but not prespecified

Stay current on Exenatide research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 30+ community reports

View community protocols

Frequently Asked Questions About Exenatide

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting