Skip to main content

Insulin

Also known as: Human Insulin, Regular Insulin, Humulin, Novolin

Research compiled by Peptide Protocol Wiki
📅Updated February 1, 2026
Citations Verified
New to metabolic peptides?Browse all metabolic peptides →

📌TL;DR

  • •Essential hormone for blood glucose regulation
  • •Over a century of clinical use with well-established safety profile
  • •Multiple formulations available (rapid, short, intermediate, long-acting)
  • •Life-saving treatment for type 1 diabetes

Community-Reported Side EffectsAnecdotal?

Protocol Quick-Reference

Blood glucose regulation in diabetes; off-label for anabolic nutrient partitioning in bodybuilding

Dosing

Amount

Diabetes: individualized (0.1-1.0 IU/kg/day total); Off-label performance: 5-15 IU rapid-acting per dose

Frequency

Diabetes: per meal and/or basal; Off-label: pre/post-workout only

Duration

Diabetes: chronic therapy; Off-label: cycles of 4-8 weeks

Administration

Route

SC

Schedule

Diabetes: per meal and/or basal; Off-label: pre/post-workout only

Timing

Rapid-acting: 15 min before meals or pre/post-workout with carbohydrates

✓ Rotate injection sites

Cycle

Duration

Diabetes: chronic therapy; Off-label: cycles of 4-8 weeks

Repeatable

Yes

Preparation & Storage

✓ Ready-to-use — no reconstitution required

⚗️ Suggested Bloodwork (6 tests)

Fasting glucose and HbA1c

When: Baseline

Why: Glycemic status baseline

Fasting insulin and C-peptide

When: Baseline

Why: Endogenous insulin production assessment

CMP

When: Baseline

Why: Metabolic baseline including electrolytes

Lipid panel

When: Baseline

Why: Insulin affects lipid metabolism

Fasting glucose

When: Daily self-monitoring

Why: Hypoglycemia prevention is paramount

HbA1c

When: Every 3 months

Why: Long-term glycemic control assessment

💡 Key Considerations
  • →Always have 10-15g fast-acting carbs per IU of insulin injected available immediately
  • →Never inject before sleep
  • →Start with 5 IU and increase by 1-2 IU per session
  • →Contraindication: LIFE-THREATENING if used without proper knowledge; contraindicated in insulinoma, hypoglycemia unawareness, and severe hepatic/renal impairment

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates — free.

150+ peptide profiles ¡ 30+ comparisons ¡ 18 research tools

Already subscribed?
Mechanism of action for Insulin
How Insulin works at the cellular level
Key benefits and uses of Insulin
Overview of Insulin benefits and applications
Scientific Details
Molecular Formula
C257H383N65O77S6
Molecular Weight
5808 Da
CAS Number
11061-68-0
Sequence
GIVEQCCTSICSLYQLENYCN-FVNQHLCGSHLVEALYLVCGERGFFYTPKT

What is Insulin?#

Insulin is a peptide that has been studied in preclinical and clinical research models for its potential therapeutic properties.

Mechanism of Action#

Insulin binds a preformed disulfide-linked ι2β2 receptor tyrosine kinase (IR) at the cell surface. Ligand binding reorients the ectodomain, relieves autoinhibition, and induces trans-autophosphorylation on activation-loop and C-terminal tyrosines of the β subunits, creating PTB/SH2 docking sites for substrates including IRS1/2, Shc, SH2B2, and Cbl.

Canonical metabolic signaling: Tyrosine-phosphorylated IRS recruits class I PI3K (p85–p110), generating PIP3 that recruits PDK1 and Akt to the membrane; PDK1 (Thr308) and mTORC2 (Ser473) activate Akt. Akt phosphorylates key substrates: TBC1D4/AS160 to disinhibit Rab GTPases controlling GLUT4 vesicle trafficking; GSK3 to relieve inhibition of glycogen synthase; TSC2 and PRAS40 to activate mTORC1 leading to S6K and lipogenic programs (e.g., SREBP1c); and FoxO transcription factors to suppress gluconeogenic gene expression.

Mitogenic signaling: Phospho‑Shc recruits Grb2–SOS to activate Ras, triggering the Raf–MEK–ERK cascade that regulates gene expression underlying growth and differentiation (parallel to metabolic signaling).

GLUT4 trafficking machinery: Insulin increases plasma-membrane GLUT4 in adipocytes and myofibers by accelerating exocytosis of GLUT4 storage vesicles. Downstream of Akt, phosphorylation of TBC1D4/AS160 permits activation of Rab8a (muscle) and Rab10 (adipose) and engages RalA/exocyst; additional regulators include SNARE-associated factors such as synip and CDP138 that facilitate vesicle docking and fusion. In adipocytes, a complementary APS/CAP/Cbl pathway in lipid rafts signals via Crk→C3G→TC10 to recruit the exocyst and aid docking.

Metabolic enzyme targets and programs:

  • Glycogen synthesis: Akt inhibits GSK3, decreasing inhibitory phosphorylation of glycogen synthase; insulin also promotes PP1-mediated dephosphorylation of glycogen synthase via scaffolds (e.g., PTG), together increasing glycogen storage.
  • Lipid metabolism: mTORC1 activation enables S6K and SREBP1c processing; SREBP1c upregulates lipogenic enzymes including ACC. In adipocytes, Akt activates PDE3B to lower cAMP and suppress PKA-dependent lipolysis, reducing fatty acid release.
  • Transcriptional control: Akt-mediated phosphorylation excludes FoxO1/3 from the nucleus, rapidly repressing hepatic gluconeogenic genes (e.g., PEPCK, G6Pase). mTORC1 further promotes SREBP1c-dependent lipogenic gene expression via lipin-1 phosphorylation and associated trafficking steps.

mTORC1 engagement and feedback: Akt phosphorylation of TSC2 disinhibits Rheb and relieves PRAS40-mediated inhibition of mTORC1, enhancing protein synthesis and lipogenesis. Negative feedback via mTORC1/S6K promotes inhibitory serine phosphorylation and degradation of IRS, attenuating upstream signaling.

Termination and negative regulation: Signaling is curtailed by PIP3 phosphatases PTEN and SHIP2; dephosphorylation of Akt by PP2A and PHLPP; protein tyrosine phosphatases such as PTP1B that dephosphorylate IR; receptor internalization and degradation; and stress-kinase pathways (JNK, IKKβ) that phosphorylate IRS serine residues to impair signaling.

Tissue-specific endpoints:

  • Skeletal muscle: Rapid GLUT4 translocation elevates glucose uptake; Akt/GSK3 signaling enhances glycogen synthesis; mTORC1 supports protein synthesis.
  • Adipose tissue: GLUT4 translocation increases glucose uptake for glycerol-3-phosphate and lipid synthesis; Akt→PDE3B suppresses lipolysis; CAP/Cbl/TC10 contributes to GLUT4 docking.
  • Liver: Akt inhibits FoxO to suppress gluconeogenesis; mTORC1/SREBP1c promotes de novo lipogenesis; Akt/GSK3 favors glycogen synthesis.

Together these pathways explain insulin’s coordinated control of vesicle trafficking, enzyme activity, and gene expression to maintain glucose and lipid homeostasis, and how feedback and phosphatases temper signaling to prevent overstimulation.

ModuleCore componentsImmediate biochemical eventsPrincipal downstream targets/effectsTissue-level endpoints
Receptor structure/activationIR α2β2; extracellular α binds insulin; β tyrosine kinaseLigand-induced trans-autophosphorylation of β subunit tyrosines; creation of PTB/SH2 docking sitesPhosphorylation of IRS, Shc, Cbl → initiation of PI3K and MAPK armsSets signalling input in muscle, adipose, liver (signal origin)
IRS–PI3K–PIP3–PDK1/mTORC2–Akt axisIRS1/2, p85/p110 PI3K, PIP3, PDK1, mTORC2, AktIRS tyrosine motifs recruit PI3K → PIP3 production; PDK1 (Thr308) and mTORC2 (Ser473) activate AktAkt phosphorylates AS160/TBC1D4, GSK3, TSC2, FoxO → GLUT4 translocation, glycogen synthase activation, mTORC1 engagement, transcriptional control↑Glucose uptake in muscle/adipose; ↓hepatic gluconeogenesis
GLUT4 trafficking machineryAS160/TBC1D4, Rab8a/Rab10, RalA/exocyst, SNAREs, synip/CDP138Akt phosphorylates AS160 → inhibits its GAP activity → activates Rab GTPases; RalA/exocyst and SNARE regulators mediate docking/fusionIncreased plasma-membrane GLUT4 density → rapid insulin-stimulated glucose uptakeMuscle and adipose primary effectors of insulin-mediated glucose disposal
mTORC1 activationTSC1/2, Rheb, PRAS40, mTORC1, S6K, lipin-1, SREBP1cAkt phosphorylates TSC2 and PRAS40 → relief of TSC-mediated mTORC1 inhibition; mTORC1 phosphorylates S6K and lipin-1Enhanced protein synthesis, S6K activation, SREBP1c-dependent lipogenesisMuscle protein synthesis ↑; hepatic and adipose lipogenesis ↑
Glycogen metabolismGSK3β, glycogen synthase (GS), PP1/PTGAkt phosphorylates and inhibits GSK3 → decreased inhibitory phosphorylation of GS; PP1 (via PTG) dephosphorylates/activates GSIncreased glycogen synthesis and storageGlycogen accumulation in muscle and liver
Lipid metabolismACC, SREBP1c, PDE3B, PKAmTORC1/SREBP1c upregulates lipogenic enzymes (ACC); Akt activates PDE3B → lowers cAMP → reduces PKA-mediated lipolysisIncreased fatty acid/triglyceride synthesis; suppressed adipocyte lipolysisHepatic TG synthesis ↑; adipose lipolysis ↓
Transcriptional controlFoxO1/3, CRTC2/CREB, SREBP1cAkt phosphorylates FoxO → nuclear exclusion/inactivation (↓gluconeogenic gene expression); mTORC1 promotes SREBP1c processingSuppressed gluconeogenesis; increased lipogenic gene expressionLiver: ↓PEPCK/G6Pase (gluconeogenesis); ↑lipogenesis via SREBP1c
Mitogenic armShc, Grb2, SOS, Ras, Raf, MEK, ERKPhospho‑Shc recruits Grb2–SOS → Ras activation → Raf→MEK→ERK kinase cascadeRegulation of gene expression driving growth, proliferation, differentiationMitogenic/growth responses across tissues (paracrine and cellular effects)
CAP/Cbl/TC10 pathwayCAP (APS), Cbl, Crk, C3G, TC10 (Rho family), exocystAPS/CAP/Cbl complex in lipid-raft domains activates Crk→C3G→TC10 GTPase → exocyst recruitmentFacilitates GLUT4 vesicle docking and fusion (complements Akt arm)Important in adipocytes for GLUT4 docking (adipose-specific contribution)
Termination/feedbackPTEN, SHIP2, PP2A, PHLPP, PTP1B, S6K, JNK, IKKβ, ubiquitin ligasesPIP3 dephosphorylation by PTEN/SHIP2; AKT dephosphorylation by PP2A/PHLPP; IRS serine phosphorylation by S6K/JNK/IKKβ; receptor endocytosis and ubi...Attenuation of insulin signalling; mechanisms underlying insulin resistance when chronically engagedContributes to systemic insulin resistance in muscle, adipose, liver

Therapeutic Applications#

Therapeutic applications of insulin span established metabolic indications and emerging neurometabolic and tissue-repair uses. Below we summarize preclinical and clinical evidence with specific outcomes.

Glycemic control in diabetes (T1D/T2D)

  • Type 1 diabetes, intensive therapy: The DCCT randomized 1,441 participants to intensive insulin therapy versus conventional therapy for a mean 6.5 years. Intensive therapy (HbA1c ≈7% vs ≈9%) reduced microvascular complications substantially: retinopathy progression decreased 76% in the primary prevention cohort and 54% in the secondary cohort; development of microalbuminuria decreased ~39% and clinical albuminuria ~56%; confirmed clinical neuropathy decreased up to ~69%. Hypoglycemia increased during intensive therapy. Benefits persisted during EDIC despite later convergence of HbA1c, demonstrating “metabolic memory.”
  • Long-term cardiovascular outcomes in T1D: Over ~30 years of DCCT/EDIC follow-up, prior intensive therapy reduced any cardiovascular disease by 30% (95% CI 7–48; P=0.016) and major cardiovascular events by ~32% (P≈0.07). Benefits were mediated by lower HbA1c during DCCT.
  • Type 2 diabetes, intensive control and legacy effect (UKPDS): In the sulfonylurea/insulin group (median HbA1c 7.0% vs 7.9% over ~10 years), microvascular disease fell by 25% and any diabetes-related endpoint by 12% during the trial; after ~10 years post-trial, legacy benefits emerged with myocardial infarction reduced by ~15% and all-cause mortality by ~13%.

Glycemic control in critical illness (ICU)

  • Across 26 trials (n≈13,567), intensive insulin therapy conferred no overall mortality benefit versus conventional control (pooled RR 0.93, 95% CI 0.83–1.04) but increased severe hypoglycemia sixfold (RR ≈6.0). Possible benefit was confined to surgical ICU subsets; overall effect and safety favor avoiding overly tight targets.

Cardiovascular adjuncts: glucose–insulin–potassium (GIK)

  • Acute MI (CREATE‑ECLA and meta-analyses): The large CREATE‑ECLA trial showed no 30‑day mortality benefit (deaths 10.0% GIK vs 9.7% control; P=0.45). Meta-analyses pooling tens of thousands of patients likewise found no reduction in 30‑day mortality (e.g., OR 1.05, 95% CI 0.97–1.14). Early hyperglycemia and fluid load in GIK arms were associated with adverse early signals.
  • Very-early EMS GIK (IMMEDIATE): Designed to test prehospital administration on progression to MI and on composites including cardiac arrest or in-hospital death and infarct size. The retrieved text describes endpoints and design but does not provide definitive numeric effects; timing may be critical. (selker2012…myocardialmetabolic pages 1-3)

Electrolyte emergencies: hyperkalemia shift therapy

  • Intravenous insulin with glucose rapidly shifts K+ intracellularly. A systematic review and ED cohorts indicate typical mean serum K+ reduction ≈0.8–1.1 mmol/L at ~60 minutes after 10 units IV regular insulin; lowering the dose (<10 U) modestly attenuates K+ reduction (e.g., 0.94 vs 1.11 mmol/L) but reduces hypoglycemia risk. Hypoglycemia occurs in ~10–21% of treated episodes, peaking between 60 and 150 minutes (often ~90 minutes), mandating glucose monitoring for ≥3 hours.

Neurologic applications: intranasal insulin

  • Mild cognitive impairment/Alzheimer disease (pilot RCT): In a 4‑month randomized, double-blind trial (n=104; 20 IU/day or 40 IU/day vs placebo), intranasal insulin improved delayed story recall at 20 IU (P<.05; Cohen f ≈0.36) and preserved study partner–rated function (DSRS) for both doses; ADAS‑Cog decline was attenuated in insulin groups, and FDG‑PET showed reduced progression of cortical hypometabolism. Group-level CSF Aβ42 and tau/Aβ42 did not change significantly, though exploratory correlations linked biomarker changes to cognitive/function outcomes. Safety was acceptable over 4 months.
  • Preclinical neuroprotection: In rodent models, intranasal insulin prevented anesthesia-induced cognitive impairment, reduced tau hyperphosphorylation and neuroinflammation, and improved spatial learning (e.g., Morris water maze), supporting mechanistic plausibility for CNS benefits.

Tissue repair: topical/local insulin for wound healing

  • Diabetic wound healing (RCT + translational data): A double‑blind, placebo‑controlled clinical trial reported that daily topical insulin cream “markedly improved wound healing” in diabetic foot ulcers. In parallel animal studies, topical insulin normalized delayed healing and enhanced insulin‑signaling pathways (IR/IRS‑1/2, AKT/ERK), VEGF, and eNOS in wound tissue.

Structured summary of applications and outcomes

ApplicationSetting / IndicationStudy / Source (year)Design / PopulationIntervention / DosePrimary OutcomesKey Quantitative ResultsNotes
DCCT — microvascular outcomesType 1 diabetes, prevention/early diseaseDiabetes Control and Complications Trial (DCCT) (1993–2002 reports)RCT, n=1,441 (primary prevention & secondary cohorts), mean follow-up ~6.5 yIntensive insulin therapy (multiple daily injections or pump) aiming ~7% HbA1c vs conventional ~9%Microvascular endpoints: retinopathy, nephropathy, neuropathyRetinopathy: 76% ↓ (primary prevention) and 54% ↓ (secondary) in 3-step ETDRS progression; nephropathy: microalbuminuria ↓ ~39%, clinical albuminur...Benefits proportional to HbA1c; hypoglycemia risk ↑ (≈3×) during intensive treatment
DCCT/EDIC — long-term CVD outcomesType 1 diabetes, long-term follow-upDCCT/EDIC 30-year update (2016, 2021)RCT then observational follow-up; ~30 years total (high retention)Prior intensive insulin during DCCT (mean 6.5 y) vs conventionalCardiovascular events (MI, stroke, CV death)Any CVD incidence ↓ 30% (95% CI 7–48%; P=0.016); major CV events ↓ ~32% (P≈0.07); long-term analyses report large reductions in major adverse event...Effect attributed to lower HbA1c during DCCT; metabolic memory / legacy effect observed
UKPDS — intensive control & legacyType 2 diabetes; newly diagnosedUKPDS and 10-yr post-trial follow-up (UKPDS; post-trial 2008/2010 summaries)RCT (sulfonylurea/insulin arm) n≈3,867; median 10-y randomized follow-up + ~10-y post-trial monitoringIntensive glucose control (sulfonylurea/insulin) achieving ~0.9% lower HbA1cMicrovascular / macrovascular endpoints; long-term (legacy) effectsDuring trial: microvascular disease RRR ~25%; any diabetes-related endpoint RRR ~12%; post-trial (10-y) legacy: MI ↓ ~15% and all-cause mortality ↓...Metformin arm showed larger CV/mortality benefits in overweight subgroup; benefits persisted post-trial (legacy effect)
Critical-illness glycemic controlICU/critically ill patientsMeta-analyses incl. NICE-SUGAR era (Finfer/NICE-SUGAR summarized in reviews/meta-analyses)Multiple RCTs / meta-analyses including NICE-SUGAR; varied ICU populationsIntensive glucose targets (tight control) vs conventional targetsMortality; severe hypoglycemiaPooled RR for death with intensive therapy ~0.93 (95% CI 0.83–1.04) — no clear mortality benefit; severe hypoglycemia RR ≈6.0 (large ↑ in hypoglyce...Net harm/benefit depends on setting (possible benefit in surgical ICU subgroups); hypoglycemia risk and monitoring critical
GIK therapy in AMI (CREATE‑ECLA + meta)Acute STEMI / AMICREATE‑ECLA trial (ECLA, 2005) and meta-analysis (Mamas et al., 2010)Large RCTs (CREATE‑ECLA ≈20,000 pts) and pooled meta-analyses (16 trials, tens of thousands)Intravenous glucose–insulin–potassium infusion (high-dose regimens) started per protocol30-day mortality / short-term mortalityCREATE‑ECLA: 30-day deaths 1004/10088 (GIK) vs 976/10107 (control), P=0.45 (no benefit); pooled meta OR ≈1.00–1.05 (95% CI spans 0.9–1.14) — no mor...Early hyperglycemia and fluid load in GIK arms implicated in neutral/negative effects; no routine use recommended based on RCT/meta evidence
IMMEDIATE trial (early out‑of‑hospital GIK) — design noteSuspected ACS treated by EMS very earlyIMMEDIATE trial (prehospital GIK; design/results reported in IMMEDIATE publications) (selker2012…myocardialmetabolic pages 1-3)EMS-administered, double-blind RCT (intent-to-treat and confirmed-ACS analyses; STEMI subgroup)Very-early IV GIK started prehospital vs placeboComposite outcomes: progression to AMI; in-hospital cardiac arrest or death; 30‑day mortality; infarct sizeTrial designed to test benefit of very-early administration; analyses focused on progression to AMI and composite of cardiac arrest/in-hospital mor...Some subgroup/modified-ITT analyses suggested benefit on specific composites; overall evidence mixed and timing crucial
Hyperkalemia — insulin–glucose shift therapyEmergency hyperkalemia (K+ ≥ ~5.5–6.0 mmol/L)Systematic reviews & comparative studies (Harel 2016; Moussavi 2020; Crnobrnja 2020 summarized)Systematic review + retrospective and comparative ED cohortsIV regular insulin (commonly 10 U IV) plus glucose (dextrose) vs lower-dose alternativesSerum K+ reduction at 30–120 min; safety (hypoglycemia incidence)Typical mean K+ fall ≈0.8–1.1 mmol/L at ~60 min after 10 U regular insulin; lower-dose (<10 U) gives slightly smaller reductions (~0.94 vs 1.11 mmo...Monitor glucose frequently for 3 h; weight- or lower-dose protocols and dextrose support reduce hypoglycemia risk
Intranasal insulin — MCI/AD (Craft et al. 2012)Amnestic MCI / mild–moderate Alzheimer diseaseCraft et al., pilot RCT (2012)Randomized, double-blind, placebo-controlled pilot; n=104 (64 aMCI, 40 AD), 4-month treatmentIntranasal regular insulin 20 IU/day (10 IU twice daily) or 40 IU/day (20 IU twice daily) vs placebo for 4 monthsCognitive (delayed story recall, ADAS‑Cog), function (DSRS, ADCS‑ADL), FDG‑PET, CSF biomarkers20 IU group: improved delayed story recall (P<.05; Cohen f ≈0.36); both insulin doses preserved study‑partner–rated function (DSRS) (P≈.01; Cohen f...Suggests dose-dependent (inverted-U) effects and short-term safety; larger trials needed for definitive efficacy and regulatory approval
Preclinical intranasal insulin — neuroprotectionAnimal models (mice/rats): anesthesia-induced cognitive impairment, STZ models of AD, agingMultiple preclinical reports (Zhang 2016; Chen 2017; Guo 2017; others summarized)Rodent models (3xTg-AD, aged mice, ICV‑STZ rats); intranasal insulin given days–weeksIntranasal insulin (varied doses e.g., 1.75 U/mouse/day; 2 U/day in rats)Behavioral memory tests (Morris water maze, fear conditioning), tau phosphorylation, neuroinflammation markersPrevented anesthesia-induced spatial learning deficits and long-term neurobehavioral changes; reduced tau hyperphosphorylation and microglial activ...Strong mechanistic/neuroprotective signals preclinically; translational challenges include delivery, dose, and long-term safety
Topical/local insulin — wound healing (Lima et al. 2012)Diabetic wounds / foot ulcersLima et al., randomized, double‑blind, placebo‑controlled clinical trial (PLoS ONE, 2012)Preclinical rat studies + RCT in diabetic patients with chronic ulcers (trial NCT01295177 subset)Topical insulin cream (selected concentration ~0.5 U/100 g in cream applied daily)Wound healing endpoints: time to granulation/closure, molecular markers (AKT/ERK, VEGF)Topical insulin normalized prolonged wound-healing time in diabetic animals and "markedly improved wound healing" in the clinical trial; molecular ...Promising adjuvant therapy; further large RCTs and standardized formulations/devices desirable

Conclusions

  • Insulin’s foundational role in chronic glycemic control translates into large and durable reductions in microvascular complications and long-term cardiovascular benefit in type 1 diabetes, with a legacy effect also evident in type 2 diabetes. In critically ill populations, tight glycemic control with insulin increases hypoglycemia and has not shown overall mortality benefit, arguing for moderated targets. As a cardiovascular adjunct in AMI, GIK has not improved mortality in modern trials. For hyperkalemia, IV insulin with dextrose reliably lowers K+ within 1–2 hours but requires vigilant hypoglycemia prevention and monitoring. Intranasal insulin shows short‑term cognitive and functional benefits in MCI/AD with supportive neuroimaging signals and preclinical mechanistic data; definitive large-scale clinical efficacy remains to be established. Topical insulin demonstrates promise in enhancing diabetic wound healing with supportive molecular findings.

Research Evidence Quality#

Scope and overall quality of evidence Insulin is essential therapy for type 1 diabetes (T1D) and frequently used in type 2 diabetes (T2D), with a large but heterogeneous evidence base. The strongest randomized evidence demonstrates that intensive insulin-based glycemic control reduces microvascular complications in T1D and that early intensive control confers durable cardiovascular benefit over decades; in T2D, large trials and meta-analyses show neutral cardiovascular effects and increased hypoglycemia relative to noninsulin therapies, while dedicated cardiovascular outcome trials (CVOTs) of modern basal insulins establish cardiovascular safety but not superiority on major adverse cardiovascular events (MACE) versus comparators at similar glycemic control (treat-to-target).

Type 1 diabetes

  • Microvascular outcomes: Intensive insulin therapy in DCCT markedly reduced development and progression of retinopathy, nephropathy, and neuropathy; EDIC follow-up showed persistent “metabolic memory” with sustained reductions in retinopathy progression despite later convergence of HbA1c.
  • Macrovascular outcomes: Over ~30 years of DCCT/EDIC, prior intensive insulin therapy reduced any cardiovascular disease by about one-third, indicating long-term macrovascular benefit attributable to earlier glycemic control.
  • Safety and patient-centered considerations: Intensive therapy is associated with weight gain and hypoglycemia risks; contemporary adjunct agents (e.g., SGLT2 inhibitors, GLP-1 receptor agonists) lack T1D CVOTs and carry their own risks, underscoring evidence gaps in modern regimens layered on insulin.

Type 2 diabetes

  • Intensive glycemic control strategies and insulin: Meta-analysis of randomized trials found no reduction in all-cause or cardiovascular mortality, and no clear macrovascular benefit with insulin versus oral agents or diet/placebo; insulin substantially increased severe hypoglycemia versus oral agents. Narrative syntheses highlight heterogeneous trial results across risk profiles, with some studies reporting neutral or even harmful mortality signals under intensive strategies in high-risk cohorts (contextualized in reviews).
  • Microvascular outcomes: In T2D, intensive glycemic control confers modest microvascular benefits in some domains, but the insulin-attributable effect on hard microvascular endpoints across trials is limited and inconsistent; the meta-analysis noted a laser photocoagulation signal largely from a single trial and emphasized methodological constraints.
  • Safety: Insulin use increases hypoglycemia risk compared with oral therapies; severe hypoglycemia is a key driver of emergency care utilization, particularly in older adults.

Basal insulin cardiovascular outcome trials (glargine, degludec)

  • Insulin glargine (ORIGIN): In older individuals with dysglycemia, targeting fasting glucose ≤95 mg/dL with glargine for >6 years had a neutral effect on MACE and cancer incidence, with modest weight gain and increased severe hypoglycemia versus standard care.
  • Insulin degludec vs glargine (DEVOTE): Treat-to-target CVOT showed noninferiority for MACE and a significantly lower rate of severe hypoglycemia with degludec relative to glargine; secondary analyses found severe hypoglycemia was temporally associated with elevated all-cause mortality risk, although causality cannot be inferred.
  • Implications: Together, these CVOTs support cardiovascular safety of modern basal analogs and highlight hypoglycemia differences across insulins at comparable HbA1c.

Pregnancy/gestational diabetes

  • We were unable to retrieve citable randomized comparisons of insulin vs metformin for gestational diabetes mellitus (GDM) within the accessible context for this analysis. Contemporary guidelines and trials outside the available citations generally compare maternal glycemic control and neonatal outcomes (e.g., hypoglycemia, macrosomia, NICU admission). Because these data were not captured in the current evidence set, conclusions for pregnancy must be considered incomplete here.

Extent of evidence and what it means

  • T1D: High-quality, long-duration RCT evidence (DCCT/EDIC) establishes intensive insulin therapy as disease-modifying for microvascular outcomes and supportive of long-term cardiovascular benefit from early glycemic control (metabolic memory), albeit with increased hypoglycemia and weight gain.
  • T2D: The randomized evidence base indicates that, beyond glycemic lowering, insulin has not demonstrated cardiovascular or mortality benefit versus noninsulin comparators and incurs higher severe hypoglycemia risk; microvascular benefits are limited and methodologically constrained across trials.
  • Basal analog CVOTs: Robust CV safety has been demonstrated for glargine and degludec; degludec reduces severe hypoglycemia relative to glargine under treat-to-target conditions, informing agent selection when insulin is indicated.

Key limitations, evidence gaps, and criticisms

  • External validity and era effects: Foundational T1D trials predate modern diabetes technologies (CGM, automated insulin delivery) and contemporary adjunct agents, limiting direct generalizability to current care paradigms.

  • Comparator limitations in T2D: Many trials compared insulin to older oral agents or standard care, not to modern cardioprotective therapies (GLP-1 receptor agonists, SGLT2 inhibitors), constraining inferences about relative clinical value in today’s therapeutic landscape.

  • Outcome neutrality for cardiovascular endpoints: Insulin-based strategies in T2D have not consistently improved MACE or mortality in randomized evidence, and observational signals of harm are confounded by indication and disease severity, complicating causal interpretation.

  • Hypoglycemia and mortality: Severe hypoglycemia is consistently more frequent with insulin than with oral agents and is temporally associated with increased mortality risk in high-risk T2D, highlighting a critical safety concern and the need for hypoglycemia-minimizing regimens.

  • Basal insulin CVOT scope: Dedicated CVOTs exist only for basal analogs (glargine, degludec); no CVOTs evaluate prandial or premixed insulins, and treat-to-target designs may attenuate detection of between-treatment differences mediated by glycemia.

  • Pregnancy: Randomized, long-term offspring safety and maternal cardiovascular outcome data comparing insulin with alternatives (e.g., metformin) are limited in the currently accessible evidence set; thus, guidance relies on broader literature outside this context (partial answer).

  • In T1D, intensive insulin therapy provides high-certainty reductions in microvascular complications and durable cardiovascular benefit from early control, offset by hypoglycemia and weight gain risks.

  • In T2D, insulin reliably lowers glucose but has not demonstrated cardiovascular or survival advantages over noninsulin therapies, and it increases severe hypoglycemia; modern basal analogs are cardiovascularly safe, with degludec reducing severe hypoglycemia vs glargine at similar HbA1c.

  • Major gaps include direct comparisons to contemporary cardioprotective agents, CVOTs for non-basal insulins, and robust pregnancy/offspring outcome data within the present evidence set.

Evidence Gaps and Limitations#

The current evidence base for Insulin consists primarily of preclinical studies. Key limitations include:

  • No completed randomized controlled trials in humans
  • Most data derived from animal models, limiting direct translatability
  • Publication bias may favor positive results
  • Long-term safety data in humans is not available
  • Optimal dosing for human applications has not been established

Key Research Findings#

The Effect of Intensive Treatment of Diabetes on the Development and Progression of Long-Term Complications in Insulin-Dependent Diabetes Mellitus, published in New England Journal of Medicine (The Diabetes Control and Complications Trial Research Group, 1993; PMID: 8366922):

  • The study demonstrated retinopathy progression decreased of 76% and 54%
  • Landmark RCT in 1441 T1D patients showing intensive insulin therapy reduced microvascular complications by 26-63% over 6.5 years versus conventional therapy

Intensive blood-glucose control with sulphonylureas or insulin compared with conventional treatment and risk of complications in patients with type 2 diabetes (UKPDS 33), published in The Lancet (UK Prospective Diabetes Study (UKPDS) Group, 1998; PMID: 9742976):

  • The study showed microvascular disease reduced by 25% with intensive versus conventional therapy
  • RCT in 3867 newly diagnosed T2D patients showing intensive glucose control reduced microvascular complications by 25% over median 10 years

Stay current on Insulin research

We summarize new studies, safety updates, and dosing insights — delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 200+ community reports

View community protocols

Frequently Asked Questions About Insulin

Research-grade suppliers verified by our scoring methodology.

Explore Further

Related Peptides

View all peptides →
⚠️

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting