Skip to main content

Insulin: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Research compiled by Peptide Protocol Wiki
📅Updated February 1, 2026
Citations Verified

📌TL;DR

  • •Molecular formula: C257H383N65O77S6
  • •Molecular weight: 5808 Da
  • •Half-life: ~6 minutes (IV); ~6-8 hours clinical duration (SC regular insulin); ~25 hours (degludec); ~196 hours (icodec)

Amino Acid Sequence

A-chain: GIVEQCCTSICSLYQLENYCN; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (51 aa, two chains linked by three disulfide bonds)

123 amino acids

Formula

C257H383N65O77S6

Molecular Weight

5808 Da

Half-Life

~6 minutes (IV); ~6-8 hours clinical duration (SC regular insulin); ~25 hours (degludec); ~196 hours (icodec)

3D molecular structure of Insulin
Three-dimensional representation of Insulin
Amino acid sequence diagram for Insulin
Color-coded amino acid sequence of Insulin

Molecular Structure and Properties#

Insulin is a peptide whose molecular structure and properties have been characterized through analytical chemistry and structural biology studies.

Amino Acid Sequence#

Molecular structure and primary sequence Human insulin is a two-chain, disulfide-linked peptide of 51 amino acids: an A chain (21 residues) and a B chain (30 residues). Canonical sequences are: A chain, GIVEQCCTSICSLYQLENYCN; B chain, FVNQHLCGSHLVEALYLVCGERGFFYTPKT. Disulfide connectivity comprises one intrachain bridge CysA6–CysA11 and two interchain bridges CysA7–CysB7 and CysA20–CysB19, establishing the native two-chain architecture. The monomer mass is approximately 5.8 kDa. These assignments derive from Sanger’s classical chemical sequencing and mapping of cystine linkages and are reiterated in subsequent structural reviews and tabulations.

ItemDetail
A-chainSequence (1-letter): GIVEQCCTSICSLYQLENYCN; Length: 21 aa; Charged @ pH 7.4: Glu4, Glu17 (–); N‑terminus (A1) +; Dominant secondary structure: heli...
B-chainSequence (1-letter): FVNQHLCGSHLVEALYLVCGERGFFYTPKT; Length: 30 aa; Charged @ pH 7.4: Glu13, Glu21 (–); Arg22 (+), Lys29 (+); His5 & His10 (partial...
Disulfide bondsConnectivity (residue numbers): intrachain A6–A11; interchain A7–B7 and A20–B19 (three cystine bridges total).
Monomer (two-chain insulin)Molecular mass ≈ 5808 Da; Isoelectric point pI ≈ 5.3; Approximate net charge at pH 7.4 ≈ –2 (residue accounting: ~4 side‑chain negatives (Glu/Asp) ...
Oligomeric statesConcentration/pH dependent: monomer favored at very low [insulin] or extreme pH (<2 or >9); dimers at higher conc./moderately acidic pH; Zn²⁺-stabi...

Secondary and higher-order structural features In solution and crystals, the A chain forms two short, nearly antiparallel α-helices (A1–A8 and A12–A19) separated by a tight turn around A9–A12. The B chain features an α-helix from B9–B19, β-turns at B7–B10 and B20–B23, and a short antiparallel β segment near B24–B28 that helps shape the classical dimer interface. Phenolic ligands stabilize an “R-state” that extends the B-chain helix toward B1–B8 within the hexamer.

Self-association and quaternary structure Insulin is monomeric at very low concentrations or at extreme pH, but readily self-associates into dimers and, with Zn2+, into toroidal hexamers. Three dimers assemble around two Zn2+ ions coordinated by HisB10 to form hexamers with distinct T6, T3R3, and R6 conformational states. Phenolic ligands (phenol, m‑cresol) favor the R6/T3R3 states by opening phenolic pockets and extending the B‑chain helix; NaCl and divalent cations modulate stability. The hexamer is roughly 50 Å in diameter and 35–40 Å in height, and contains a central cavity whose six GluB13 side chains can bind additional divalent ions (e.g., Cd2+, Ca2+). In β‑cell granules (mildly acidic, zinc‑rich), insulin is stored as Zn‑hexamer microcrystals near its isoelectric point.

Physicochemical properties: isoelectric point, charge, and solubility The isoelectric point of human insulin is approximately 5.3. Solubility is poor in the pH 4–6.5 range and increases at pH values far from the pI (e.g., pH 2 or pH 10); however, strongly acidic conditions can accelerate fibrillation and chemical degradation during handling. Around neutral pH, insulin’s net charge is slightly negative (on the order of −1 to −2) due to the balance of acidic residues (e.g., GluA4, GluA17, GluB13, GluB21) versus basic residues (ArgB22, LysB29), with N‑ and C‑terminal charges and partially protonated histidines (HisB5, HisB10) making small contributions. The charge distribution is heterogeneous: negative clusters near B13/B21 and A4/A17, positive charges at B22/B29 and chain N‑termini. In the hexamer, coordination by HisB10 requires reduced protonation at near‑neutral pH. For analytical quantitation, ε280 = 5734 M−1 cm−1 is commonly used.

Aggregation and stability behavior Physical stability reflects the interplay between conformation and self‑association. Agitation, interfaces, and elevated temperature promote fibrillation, particularly at low pH, whereas Zn2+ and phenolic excipients stabilize hexamers and mitigate fibrillation in pharmaceutical formulations. Near the pI, small pH shifts or trace metal ions can trigger isoelectric precipitation; increasing ionic strength (e.g., NaCl) stabilizes hexamers but can also enhance fibrillation propensity.

Summary Insulin’s two-chain, tri‑cystine architecture encodes a compact fold with defined α‑helices and a β segment that support receptor engagement and controlled self‑assembly. Its pI near 5.3 and heterogeneous charge distribution underlie characteristic solubility and association behavior, including Zn2+/phenol‑driven hexamer formation and pH‑dependent aggregation dynamics, which are central to its biological storage and pharmaceutical formulation.

Stability and Formulation#

Insulin stability is governed by pH-dependent solubility, temperature-driven kinetics, defined chemical and physical degradation pathways, and formulation choices that control association state and interfacial behavior.

pH stability and solubility • Insulin exhibits minimal solubility and is prone to precipitation in its isoelectric zone, reported around pH 4.5–6.5; small pH drifts into this region can trigger visible precipitation in otherwise neutral formulations. Neutral pH formulations are generally more stable than acidic ones historically used for regular insulin (pH ~2.8–3.5). • Acidic versus neutral formulations show different chemical liabilities: acid favors AsnA21 deamidation, while neutral/alkaline favors AsnB3 deamidation via a succinimide intermediate (see below). Insulin glargine leverages pH-dependent solubility: it is formulated around pH 4 and precipitates in the subcutaneous space because added basic residues shift the isoelectric point toward neutrality, creating a protracted depot.

Temperature sensitivity and storage • Degradation accelerates markedly with temperature; many pathways proceed on the order of 5–10× faster at 37°C than 4°C. Cold-chain storage at 2–8°C underpins typical two‑year shelf life. In-use storage below about 25–30°C is recommended with product-specific discard windows (often 15–30 days). Freezing can induce precipitation and damage suspensions. Heat alone is tolerated better than heat plus agitation, which rapidly induces fibrillation.

Degradation pathways • Chemical pathways: – Deamidation: Acid-catalyzed AsnA21 deamidation predominates in acidic solutions; in neutral/alkaline media AsnB3 deamidation occurs via a cyclic succinimide to Asp/isoAsp. Phenol retards B3 deamidation by rigidifying the B1–B6 segment. Deamidation rates increase with temperature and many products retain near-native activity. – Transpeptidation/oligomerization: Covalent dimers/oligomers arise by aminolysis, typically involving the B1 α-amino group; aldehyde impurities in glycerol can promote such crosslinking. Blocking B1 prevents this pathway. – Disulfide scrambling/polymerization: Disulfide interchange following initial cystine cleavage yields higher-molecular-weight polymers, observed to form several-fold faster at 37°C than 4°C. – Oxidation/metal-associated cross-links: Oxidative modifications and metal-associated crosslinking have been reported and can modulate aggregation and fibrillation behavior. • Physical pathways: – Aggregation and fibrillation: Fibrillation proceeds after monomerization with exposure of normally buried hydrophobic residues (notably A2, B11, B15) and displacement of the B‑chain C‑terminus, forming cross‑β assemblies. A lag phase precedes rapid growth; interfaces (air–water, plastic–water), agitation, and shear catalyze nucleation. Adsorption to hydrophobic surfaces contributes to loss, particularly in dilute solutions.

Formulation considerations • Buffers and pH control: Use buffering (commonly phosphate) to avoid drift into the isoelectric precipitation region and to counteract CO2 absorption or acid leachables; methylparaben hydrolysis can lower pH over time. • Zinc and phenolic ligands: Zinc coordinates the hexamer (via B10 His), and phenol or m‑cresol bind at nonpolar inter-dimer pockets to stabilize the R6 hexamer, enhancing shelf-life and reducing fibrillation, while requiring preservative diffusion post-injection to permit hexamer dissociation and absorption. Excess free zinc (>~6 atoms per hexamer) promotes crystalline phases and phase stability used in Lente-type products. • Preservatives and alternatives: Phenol/m‑cresol provide antimicrobial activity and stabilize hexamers; alternative systems (e.g., phenoxyethanol, parabens) alter association states and, in combination with amphiphilic polymers, can favor monomer-rich formulations in stress testing. Preservative depletion or incompatibilities can destabilize products, so preservative–API–excipient compatibility must be verified. • Surfactants and amphiphiles: Low concentrations of nonionic surfactants (e.g., polysorbate 80/Tween) or lecithins reduce interfacial nucleation by covering air–water and solid–liquid interfaces; amphiphilic copolymers can further suppress interfacial aggregation and enable monomer-rich formulations under stress. Albumin can mitigate adsorption losses. Note surfactants may alter aggregate morphology and themselves require stability control. • Ionic strength and metal ions: Ionic strength and specific ions modulate aggregation kinetics; divalent cations or leached metals can alter solubility and induce precipitation. Control source water, stopper compatibility, and chelators as appropriate; maintain targeted zinc levels. • Device materials and agitation: Hydrophobic materials (e.g., silicone rubber) and agitation promote adsorption and aggregation; hydrophilic materials are more compatible. Minimize shaking, foaming, and air–liquid interfaces during manufacturing and use.

Key practical summary • Avoid pH 4.5–6.5 in solution; maintain robust buffering near neutral pH for regular/rapid insulins. Use cold-chain storage (2–8°C); limit in‑use exposure to ≤25–30°C and avoid freezing. Mitigate chemical degradation by controlling pH, temperature, excipient purity (e.g., glycerol aldehydes), and by leveraging phenol for B3 protection when appropriate. Limit physical aggregation by stabilizing hexamers with zinc/phenolics or, conversely, by combining alternative preservatives with interfacial blockers if monomer-rich designs are intended; mitigate interfaces with surfactants or amphiphilic polymers and select compatible device materials.

Embedded summary table

AspectFindings / MechanismsPractical ranges / conditionsKey excipients / materialsNotes
pH stability / solubilityIsoelectric precipitation near pI (~5–6) causes minimal solubility; acidic formulations (historical pH ~2.8–3.5) are less stable than neutral; glar...Isoelectric zone ~pH 4.5–6.5; neutral formulations (~pH 7) generally more stable; acidic product windows as noted above.Buffers (phosphate), zinc, phenol/m-cresol to favor hexameric states.Small pH shifts from CO2 diffusion or leachables can trigger precipitation; control buffering.
Temperature sensitivity & storageDegradation (chemical and physical) accelerates with temperature; many reactions proceed ~5–10× faster at 37°C vs 4°C; heat + agitation strongly pr...Cold chain 2–8°C for shelf life (~2 years); in-use storage typically <25–30°C with product-specific discard windows (e.g., 15–30 days); avoid freez...Microcrystalline forms (NPH/Lente), zinc-stabilized hexamers; controlled excipients to slow kinetics.Elevated T increases both deamidation and aggregation rates; follow manufacturer in-use times.
Chemical degradationMajor pathways: acid-catalyzed deamidation at AsnA21 and base/neutral deamidation at AsnB3 via succinimide; transpeptidation (B1 amine) yields cova...A21 deamidation promoted at low pH; B3 deamidation at neutral/alkaline pH; rates increase with temperature (high activation energies/Q10).Phenol reduces B3 deamidation (rigidifies B1–B6); avoid glycerol with aldehyde impurities; use high-purity API and control excipient impurities.Many deamidated species retain activity, but HMW aggregates lose potency and may raise safety concerns.
Physical degradation (aggregation / fibrillation)Fibrillation proceeds after monomerization/exposure of hydrophobic residues (A2, B11, B15) and B-chain C-terminal displacement to form cross-β asse...Agitated/heat-stressed assays (e.g., 37°C + shaking) rapidly induce aggregates; lower protein concentrations sometimes paradoxically increase fibri...Surfactants (Tween/Polysorbate), lecithins, albumin, amphiphilic polymers to protect interfaces; zinc/phenol to favor hexamer and reduce monomer ex...Fibrils are often irreversible under physiological conditions and can alter immunogenicity/PK; control interfaces and agitation during handling.
Zinc / phenolic ligands & association stateZn2+ coordinates insulin (B10 His) to form hexamers; phenol/m-cresol bind nonpolar pockets and stabilize the R6 hexamer (conformational change), sl...Free Zn > ~6 atoms/hexamer promotes crystalline phases (Lente-type) and phase stability; phenolic ligands used in typical formulations to stabilize...Zinc salts, phenol, m-cresol, protamine (for NPH).Hexamer stabilization improves shelf-life but requires preservative diffusion at injection site for monomer release and bioavailability.
Preservatives & alternativesPhenol and m-cresol provide antimicrobial activity and stabilize hexamers; alternative preservatives (phenoxyethanol, parabens) differ in hexamer b...Preserve antimicrobial activity while minimizing aggregation risk; phenoxyethanol used in some zinc-free/monomeric lispro formulations (with polyme...Phenol, m-cresol, phenoxyethanol, methyl/propylparaben (formulation-dependent).Preservative depletion or interaction with other excipients can destabilize product; test preservative–API compatibility.
Surfactants / amphiphiles / polymersNonionic surfactants and amphiphilic copolymers reduce interfacial nucleation by occupying air–water interfaces; polysorbate 80 can slow aggregatio...Low concentrations effective; surfactant > CMC can change aggregate packing; polymer concentrations >0.1 g/mL reported to stabilize monomer-rich li...Polysorbate 80, Tween, lecithins, amphiphilic copolymers (MoNi), albumin (0.1–1% used to limit adsorption).Surfactants themselves can oxidize/degrade (impacting stability) and may modify aggregate properties; monitor surfactant stability.
Buffers / ionic strength / metalsBuffers (phosphate) mitigate pH drift (CO2 diffusion, hydrolysis of excipients) and help avoid isoelectric precipitation; ionic strength and specif...Use controlled phosphate buffering, limit metal contaminants, and adjust ionic strength during formulation development; monitor Zn2+ for desired ph...Phosphate buffer, chelators (EDTA) in process where appropriate, compatible stopper materials (avoid leachable metals).Device/material compatibility (stoppers, syringes) is critical; hydrophobic materials and silicone can accelerate degradation.

Pharmacokinetics#

We summarize pharmacokinetics (PK) of insulin in humans across formulations, focusing on numeric data for absorption, distribution, metabolism, elimination, half-life, and bioavailability.

Overall principles

  • Endogenous insulin entering via the portal vein undergoes substantial hepatic extraction; exogenous insulin given IV or SC distributes systemically and is cleared by receptor-mediated uptake and proteolysis, with kidneys and liver both contributing to elimination. In clinical sources, renal contribution to circulating insulin elimination is often substantial (≈30–80%), and renal impairment can increase exposure for some analogs; hepatic extraction and insulin-degrading enzyme (IDE) mediate metabolism (system-level summaries).

Regular human insulin: IV disposition and distribution

  • Plasma half-life: approximately 6 minutes after IV administration or during steady infusion, reflecting very rapid plasma disappearance.
  • Metabolic clearance rate (MCR): about 0.60 L¡min⁝š¡m⁝²; total distribution volume ≈6.7 L¡m⁝² from IV kinetic studies and modeling used to deconvolute SC appearance.
  • Modeled apparent V (assuming SC F=1) in population analyses: ≈7.4 L; apparent CL/F in healthy volunteers ≈103 L/h and ≈20.8 L/h in type 1 diabetes (reflecting model/relative F differences).

Subcutaneous regular human insulin: absorption, bioavailability, duration

  • Absorption time course: onset ~30 minutes; peak effect/concentration around 60–120 minutes; clinical duration ~6–8 hours.
  • Completeness of absorption: during pump therapy (CSII) with labeled insulin, cumulative 24-hour systemic uptake closely matched delivered dose (differences <3%), indicating near-complete absorption from the SC depot under steady delivery; bolus peaks typically 30–90 minutes.

Rapid-acting analogs (aspart, lispro, glulisine): SC kinetics

  • Engineered to reduce self-association, leading to faster absorption: onset 5–20 minutes, peak 30–60 minutes, duration ≈3–5 hours. Clinical factors (obesity, site, exercise) modulate these values.

Inhaled human insulin: absorption and relative bioavailability

  • Population PK/PD modeling indicates rapid pulmonary absorption with first-order kinetics (ka_inh ≈0.25 h⁝š in healthy volunteers) and low absolute systemic exposure versus SC: relative bioavailability ≈7.9% in healthy volunteers; dose-dependent relative bioavailability ≈6.9–17.2% in type 1 diabetes.

Long-acting and ultra-long-acting basal analogs

  • Degludec: Protracted via multihexamer formation in SC tissue; reported half-life about 25 hours, yielding a flat basal profile.
  • Icodec (once-weekly basal insulin): Designed for strong, reversible albumin binding creating a circulating depot; mean plasma half-life ≈196 hours (~1 week) with even distribution of glucose-lowering over the dosing interval in clinical pharmacology trials.

Mechanistic factors affecting SC absorption and distribution

  • Self-association state (monomer/dimer vs hexamer), depot geometry and volume, local blood flow, temperature, exercise, and injection site all affect rate and variability of SC absorption; albumin binding (acylated analogs) slows absorption and reduces clearance. These principles underlie differences between prandial and basal insulins.

Embedded comparative PK table

Formulation / RouteAbsorption (onset, Tmax)BioavailabilityDistribution (Vd, binding)MetabolismElimination / ClearanceHalf-life / Duration
Regular human insulin — IV bolus/infusionImmediate systemic exposure (IV); no Tmax (IV)100% (IV)Vd ≈ 6.7 L/m2 (IV measured); apparent V ≈ 7.4 L (model, assumes F=1)Proteolytic degradation (insulinase/IDE); hepatic extraction importantMetabolic clearance (MCR) ≈ 0.60 L·min−1·m−2 (reported ~0.6041/min/m2)Plasma t1/2 ≈ 6 min (rapid disappearance)
Regular human insulin — Subcutaneous injectionOnset ≈ 30 min; Tmax ≈ 60–120 minGenerally high; reported ranges include ~73% in some studies and near-complete uptake over 24 h (~97–100%) in pump/IV replacement studiesApparent V (model) ≈ 7.4 L (when assuming F=1)Proteolytic degradation in tissue and systemic (IDE); hepatic and renal rolesRenal contribution reported ~30–80% of systemic insulin elimination (varies by study); overall systemic clearance as aboveApparent clinical duration ≈ 6–8 h (regular insulin)
Rapid-acting analogs (aspart, lispro, glulisine) — SubcutaneousOnset ≈ 5–20 min; Tmax ≈ 30–60 minSC bioavailability generally comparable to human insulin (high)Apparent V similar to human insulin in PK models (≈7.4 L modeled); engineered analogs reduce self-association to speed absorption; some analogs alt...Proteolytic degradation (IDE and systemic proteases)Clearance variable; exposure/clearance may change with obesity or renal impairmentDuration of action ≈ 3–5 h (prandial profile)
CSII (continuous subcutaneous infusion; pump)Bolus peaks reported ~30–90 min after meal bolus; continuous infusion yields steady-state levelsNear-complete systemic uptake from SC depot over 24 h (total absorption closely matches delivered dose; differences <3%)Apparent V consistent with SC/IV estimates (models often use ≈7.4 L)Minimal extra local SC degradation during continuous infusion (systemic proteolysis after absorption)Systemic clearance similar to IV once absorbed; kinetics fitted by single/two-pool modelsApparent plasma disappearance half-time during infusion reported ≈6 min for systemic insulin; clinical basal coverage maintained via infusion
Inhaled human insulin (pulmonary)Rapid pulmonary absorption; absorption kinetics dose-dependent (models reported ka_inh ≈ 0.252 h−1 with dose-dependent changes)Relative bioavailability vs SC ≈ 7.9% in healthy volunteers; reported dose-dependent range ≈ 6.9–17.2% in T1D (lower systemic exposure vs SC)Apparent V used in models for comparisons ≈7.4 L (modeling assumes SC-F basis); distribution after absorption systemicProteolytic degradation after systemic absorption (same systemic metabolic pathways)Lower systemic exposure owing to incomplete pulmonary bioavailability; apparent clearance estimates derive from population modelsFaster onset of action clinically (prandial profile); overall shorter latency vs SC prandial in some studies
Insulin degludec — Subcutaneous (long-acting)Very protracted/slow absorption from SC depot via multihexamer formationSC bioavailability high (designed for reliable basal exposure)Protraction via multihexamer depot formation in SC tissue; albumin binding not required for degludec's protractionProteolytic degradation after systemic absorptionApparent clearance is low vs short-acting insulins leading to prolonged exposurePlasma/functional half-life ≈ 25 h (protracted, very flat basal profile)
Insulin icodec — Subcutaneous (once-weekly, ultra-long-acting)Slow/protracted absorption with formation of an albumin-associated circulating depot (designed for even weekly coverage)SC exposure suitable for once-weekly dosing (formulation/PK optimized for weekly exposure)Strong, reversible albumin binding produces extended apparent V/plasma retention (albumin-bound circulating depot)Reduced apparent clearance due to albumin binding and reduced receptor-mediated clearanceVery slow apparent systemic clearance consistent with weekly dosing requirementsPlasma half-life ≈ 196 h (~1 week) — protracted, near-even glucose-lowering over dosing interval

Notes on metabolism and elimination

  • After systemic absorption, insulin is cleared by receptor-mediated endocytosis and proteolytic degradation (IDE and related proteases). Renal excretion and degradation make a substantial contribution to circulating insulin clearance, with changes in renal function altering exposure for some rapid-acting analogs; hepatic dysfunction can variably affect certain long-acting analogs. These clinical patterns are summarized in special-population analyses.

Conclusion

  • Regular human insulin exhibits a very short IV half-life (~6 min), small distribution volume (≈6.7 L¡m⁝²), and high SC uptake with onset/peaks at ~0.5–2 h and duration 6–8 h. Rapid analogs accelerate absorption (onset 5–20 min, duration 3–5 h). Inhaled insulin provides faster onset but low relative systemic bioavailability (~8% vs SC). Basal analogs extend apparent half-life via formulation/molecular design: degludec (~25 h) and icodec (~196 h) deliver sustained exposure suitable for once-daily or once-weekly dosing, respectively. These PK properties, together with patient and injection-site factors, govern clinical insulin selection and dosing.

Frequently Asked Questions About Insulin

What type of peptide is Insulin?

Insulin is a 51-amino acid peptide hormone produced by pancreatic beta cells, consisting of an A-chain (21 amino acids) and B-chain (30 amino acids) linked by disulfide bonds. It is the primary regulator of blood glucose homeostasis and has been used therapeutically since 1922 for diabetes management.

What is the half-life of Insulin?

The reported half-life of Insulin is ~6 minutes (IV); ~6-8 hours clinical duration (SC regular insulin); ~25 hours (degludec); ~196 hours (icodec). Half-life can vary depending on the route of administration, formulation, and individual factors. This information is based on available preclinical or pharmacokinetic data.

What is the amino acid sequence of Insulin?

The amino acid sequence of Insulin is A-chain: GIVEQCCTSICSLYQLENYCN; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (51 aa, two chains linked by three disulfide bonds). This sequence determines its biological activity and binding properties.

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer