Insulin: Molecular Structure

Molecular Structure and Properties#

Insulin is a peptide whose molecular structure and properties have been characterized through analytical chemistry and structural biology studies.

Amino Acid Sequence#

Molecular structure and primary sequence Human insulin is a two-chain, disulfide-linked peptide of 51 amino acids: an A chain (21 residues) and a B chain (30 residues). Canonical sequences are: A chain, GIVEQCCTSICSLYQLENYCN; B chain, FVNQHLCGSHLVEALYLVCGERGFFYTPKT. Disulfide connectivity comprises one intrachain bridge CysA6–CysA11 and two interchain bridges CysA7–CysB7 and CysA20–CysB19, establishing the native two-chain architecture. The monomer mass is approximately 5.8 kDa. These assignments derive from Sanger’s classical chemical sequencing and mapping of cystine linkages and are reiterated in subsequent structural reviews and tabulations.

Secondary and higher-order structural features In solution and crystals, the A chain forms two short, nearly antiparallel α-helices (A1–A8 and A12–A19) separated by a tight turn around A9–A12. The B chain features an α-helix from B9–B19, β-turns at B7–B10 and B20–B23, and a short antiparallel β segment near B24–B28 that helps shape the classical dimer interface. Phenolic ligands stabilize an “R-state” that extends the B-chain helix toward B1–B8 within the hexamer.

Self-association and quaternary structure Insulin is monomeric at very low concentrations or at extreme pH, but readily self-associates into dimers and, with Zn2+, into toroidal hexamers. Three dimers assemble around two Zn2+ ions coordinated by HisB10 to form hexamers with distinct T6, T3R3, and R6 conformational states. Phenolic ligands (phenol, m‑cresol) favor the R6/T3R3 states by opening phenolic pockets and extending the B‑chain helix; NaCl and divalent cations modulate stability. The hexamer is roughly 50 Å in diameter and 35–40 Å in height, and contains a central cavity whose six GluB13 side chains can bind additional divalent ions (e.g., Cd2+, Ca2+). In β‑cell granules (mildly acidic, zinc‑rich), insulin is stored as Zn‑hexamer microcrystals near its isoelectric point.

Physicochemical properties: isoelectric point, charge, and solubility The isoelectric point of human insulin is approximately 5.3. Solubility is poor in the pH 4–6.5 range and increases at pH values far from the pI (e.g., pH 2 or pH 10); however, strongly acidic conditions can accelerate fibrillation and chemical degradation during handling. Around neutral pH, insulin’s net charge is slightly negative (on the order of −1 to −2) due to the balance of acidic residues (e.g., GluA4, GluA17, GluB13, GluB21) versus basic residues (ArgB22, LysB29), with N‑ and C‑terminal charges and partially protonated histidines (HisB5, HisB10) making small contributions. The charge distribution is heterogeneous: negative clusters near B13/B21 and A4/A17, positive charges at B22/B29 and chain N‑termini. In the hexamer, coordination by HisB10 requires reduced protonation at near‑neutral pH. For analytical quantitation, ε280 = 5734 M−1 cm−1 is commonly used.

Aggregation and stability behavior Physical stability reflects the interplay between conformation and self‑association. Agitation, interfaces, and elevated temperature promote fibrillation, particularly at low pH, whereas Zn2+ and phenolic excipients stabilize hexamers and mitigate fibrillation in pharmaceutical formulations. Near the pI, small pH shifts or trace metal ions can trigger isoelectric precipitation; increasing ionic strength (e.g., NaCl) stabilizes hexamers but can also enhance fibrillation propensity.

Summary Insulin’s two-chain, tri‑cystine architecture encodes a compact fold with defined α‑helices and a β segment that support receptor engagement and controlled self‑assembly. Its pI near 5.3 and heterogeneous charge distribution underlie characteristic solubility and association behavior, including Zn2+/phenol‑driven hexamer formation and pH‑dependent aggregation dynamics, which are central to its biological storage and pharmaceutical formulation.

Stability and Formulation#

Insulin stability is governed by pH-dependent solubility, temperature-driven kinetics, defined chemical and physical degradation pathways, and formulation choices that control association state and interfacial behavior.

pH stability and solubility • Insulin exhibits minimal solubility and is prone to precipitation in its isoelectric zone, reported around pH 4.5–6.5; small pH drifts into this region can trigger visible precipitation in otherwise neutral formulations. Neutral pH formulations are generally more stable than acidic ones historically used for regular insulin (pH ~2.8–3.5). • Acidic versus neutral formulations show different chemical liabilities: acid favors AsnA21 deamidation, while neutral/alkaline favors AsnB3 deamidation via a succinimide intermediate (see below). Insulin glargine leverages pH-dependent solubility: it is formulated around pH 4 and precipitates in the subcutaneous space because added basic residues shift the isoelectric point toward neutrality, creating a protracted depot.

Temperature sensitivity and storage • Degradation accelerates markedly with temperature; many pathways proceed on the order of 5–10× faster at 37°C than 4°C. Cold-chain storage at 2–8°C underpins typical two‑year shelf life. In-use storage below about 25–30°C is recommended with product-specific discard windows (often 15–30 days). Freezing can induce precipitation and damage suspensions. Heat alone is tolerated better than heat plus agitation, which rapidly induces fibrillation.

Degradation pathways • Chemical pathways: – Deamidation: Acid-catalyzed AsnA21 deamidation predominates in acidic solutions; in neutral/alkaline media AsnB3 deamidation occurs via a cyclic succinimide to Asp/isoAsp. Phenol retards B3 deamidation by rigidifying the B1–B6 segment. Deamidation rates increase with temperature and many products retain near-native activity. – Transpeptidation/oligomerization: Covalent dimers/oligomers arise by aminolysis, typically involving the B1 α-amino group; aldehyde impurities in glycerol can promote such crosslinking. Blocking B1 prevents this pathway. – Disulfide scrambling/polymerization: Disulfide interchange following initial cystine cleavage yields higher-molecular-weight polymers, observed to form several-fold faster at 37°C than 4°C. – Oxidation/metal-associated cross-links: Oxidative modifications and metal-associated crosslinking have been reported and can modulate aggregation and fibrillation behavior. • Physical pathways: – Aggregation and fibrillation: Fibrillation proceeds after monomerization with exposure of normally buried hydrophobic residues (notably A2, B11, B15) and displacement of the B‑chain C‑terminus, forming cross‑β assemblies. A lag phase precedes rapid growth; interfaces (air–water, plastic–water), agitation, and shear catalyze nucleation. Adsorption to hydrophobic surfaces contributes to loss, particularly in dilute solutions.

Formulation considerations • Buffers and pH control: Use buffering (commonly phosphate) to avoid drift into the isoelectric precipitation region and to counteract CO2 absorption or acid leachables; methylparaben hydrolysis can lower pH over time. • Zinc and phenolic ligands: Zinc coordinates the hexamer (via B10 His), and phenol or m‑cresol bind at nonpolar inter-dimer pockets to stabilize the R6 hexamer, enhancing shelf-life and reducing fibrillation, while requiring preservative diffusion post-injection to permit hexamer dissociation and absorption. Excess free zinc (>~6 atoms per hexamer) promotes crystalline phases and phase stability used in Lente-type products. • Preservatives and alternatives: Phenol/m‑cresol provide antimicrobial activity and stabilize hexamers; alternative systems (e.g., phenoxyethanol, parabens) alter association states and, in combination with amphiphilic polymers, can favor monomer-rich formulations in stress testing. Preservative depletion or incompatibilities can destabilize products, so preservative–API–excipient compatibility must be verified. • Surfactants and amphiphiles: Low concentrations of nonionic surfactants (e.g., polysorbate 80/Tween) or lecithins reduce interfacial nucleation by covering air–water and solid–liquid interfaces; amphiphilic copolymers can further suppress interfacial aggregation and enable monomer-rich formulations under stress. Albumin can mitigate adsorption losses. Note surfactants may alter aggregate morphology and themselves require stability control. • Ionic strength and metal ions: Ionic strength and specific ions modulate aggregation kinetics; divalent cations or leached metals can alter solubility and induce precipitation. Control source water, stopper compatibility, and chelators as appropriate; maintain targeted zinc levels. • Device materials and agitation: Hydrophobic materials (e.g., silicone rubber) and agitation promote adsorption and aggregation; hydrophilic materials are more compatible. Minimize shaking, foaming, and air–liquid interfaces during manufacturing and use.

Key practical summary • Avoid pH 4.5–6.5 in solution; maintain robust buffering near neutral pH for regular/rapid insulins. Use cold-chain storage (2–8°C); limit in‑use exposure to ≤25–30°C and avoid freezing. Mitigate chemical degradation by controlling pH, temperature, excipient purity (e.g., glycerol aldehydes), and by leveraging phenol for B3 protection when appropriate. Limit physical aggregation by stabilizing hexamers with zinc/phenolics or, conversely, by combining alternative preservatives with interfacial blockers if monomer-rich designs are intended; mitigate interfaces with surfactants or amphiphilic polymers and select compatible device materials.

Embedded summary table

Pharmacokinetics#

We summarize pharmacokinetics (PK) of insulin in humans across formulations, focusing on numeric data for absorption, distribution, metabolism, elimination, half-life, and bioavailability.

Overall principles

• Endogenous insulin entering via the portal vein undergoes substantial hepatic extraction; exogenous insulin given IV or SC distributes systemically and is cleared by receptor-mediated uptake and proteolysis, with kidneys and liver both contributing to elimination. In clinical sources, renal contribution to circulating insulin elimination is often substantial (≈30–80%), and renal impairment can increase exposure for some analogs; hepatic extraction and insulin-degrading enzyme (IDE) mediate metabolism (system-level summaries).

Regular human insulin: IV disposition and distribution

• Plasma half-life: approximately 6 minutes after IV administration or during steady infusion, reflecting very rapid plasma disappearance.
• Metabolic clearance rate (MCR): about 0.60 L·min⁻¹·m⁻²; total distribution volume ≈6.7 L·m⁻² from IV kinetic studies and modeling used to deconvolute SC appearance.
• Modeled apparent V (assuming SC F=1) in population analyses: ≈7.4 L; apparent CL/F in healthy volunteers ≈103 L/h and ≈20.8 L/h in type 1 diabetes (reflecting model/relative F differences).

Subcutaneous regular human insulin: absorption, bioavailability, duration

• Absorption time course: onset ~30 minutes; peak effect/concentration around 60–120 minutes; clinical duration ~6–8 hours.
• Completeness of absorption: during pump therapy (CSII) with labeled insulin, cumulative 24-hour systemic uptake closely matched delivered dose (differences <3%), indicating near-complete absorption from the SC depot under steady delivery; bolus peaks typically 30–90 minutes.

Rapid-acting analogs (aspart, lispro, glulisine): SC kinetics

• Engineered to reduce self-association, leading to faster absorption: onset 5–20 minutes, peak 30–60 minutes, duration ≈3–5 hours. Clinical factors (obesity, site, exercise) modulate these values.

Inhaled human insulin: absorption and relative bioavailability

• Population PK/PD modeling indicates rapid pulmonary absorption with first-order kinetics (ka_inh ≈0.25 h⁻¹ in healthy volunteers) and low absolute systemic exposure versus SC: relative bioavailability ≈7.9% in healthy volunteers; dose-dependent relative bioavailability ≈6.9–17.2% in type 1 diabetes.

Long-acting and ultra-long-acting basal analogs

• Degludec: Protracted via multihexamer formation in SC tissue; reported half-life about 25 hours, yielding a flat basal profile.
• Icodec (once-weekly basal insulin): Designed for strong, reversible albumin binding creating a circulating depot; mean plasma half-life ≈196 hours (~1 week) with even distribution of glucose-lowering over the dosing interval in clinical pharmacology trials.

Mechanistic factors affecting SC absorption and distribution

• Self-association state (monomer/dimer vs hexamer), depot geometry and volume, local blood flow, temperature, exercise, and injection site all affect rate and variability of SC absorption; albumin binding (acylated analogs) slows absorption and reduces clearance. These principles underlie differences between prandial and basal insulins.

Embedded comparative PK table

Notes on metabolism and elimination

• After systemic absorption, insulin is cleared by receptor-mediated endocytosis and proteolytic degradation (IDE and related proteases). Renal excretion and degradation make a substantial contribution to circulating insulin clearance, with changes in renal function altering exposure for some rapid-acting analogs; hepatic dysfunction can variably affect certain long-acting analogs. These clinical patterns are summarized in special-population analyses.

Conclusion

• Regular human insulin exhibits a very short IV half-life (~6 min), small distribution volume (≈6.7 L·m⁻²), and high SC uptake with onset/peaks at ~0.5–2 h and duration 6–8 h. Rapid analogs accelerate absorption (onset 5–20 min, duration 3–5 h). Inhaled insulin provides faster onset but low relative systemic bioavailability (~8% vs SC). Basal analogs extend apparent half-life via formulation/molecular design: degludec (~25 h) and icodec (~196 h) deliver sustained exposure suitable for once-daily or once-weekly dosing, respectively. These PK properties, together with patient and injection-site factors, govern clinical insulin selection and dosing.

Related Reading#

• Insulin overview and research guide
• Peptides similar to Insulin
• Insulin research evidence