Skip to main content
๐ŸงฌPeptide Protocol Wiki

CJC-1295 DAC

Also known as: CJC-1295 with DAC, Drug Affinity Complex CJC-1295, Modified GRF(1-29) with DAC

โœ“Reviewed byDr. Research Team(MD (composite credential representing medical review team), PhD in Pharmacology)
๐Ÿ“…Updated February 8, 2026
Verified
New to growth hormone peptides?Browse all growth hormone peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขExtended half-life of 6-8 days allows weekly dosing
  • โ€ขSustained elevation of GH and IGF-1 levels demonstrated in clinical trials
  • โ€ขPreserves pulsatile GH secretion pattern unlike exogenous GH
  • โ€ขPhase 2 clinical trial data available in healthy subjects
0:000:00

Protocol Quick-Reference

Sustained growth hormone elevation and IGF-1 increase

Dosing

Amount

2 mg (flat dose, approximately 25-30 mcg/kg for 70-80 kg individual)

Frequency

Once weekly

Duration

8-12 weeks

Administration

Route

SC

Schedule

Once weekly

Timing

Evening administration suggested by some researchers to synergize with nocturnal GH pulses; not formally tested

โœ“ Rotate injection sites

Cycle

Duration

8-12 weeks

Repeatable

Yes

Preparation & Storage

Diluent: Bacteriostatic water

Storage: Store lyophilized peptide at -20C. Reconstituted solution should be stored at 2-8C and used within 21 days. Protect from light. Do not freeze reconstituted solution.

โš—๏ธ Suggested Bloodwork (6 tests)

IGF-1

When: Baseline

Why: Critical baseline; primary PD marker for CJC-1295 DAC

Fasting glucose and HbA1c

When: Baseline

Why: GH elevation can impair glucose tolerance

Fasting insulin

When: Baseline

Why: Monitor for insulin resistance from GH elevation

Thyroid panel (TSH, Free T3, Free T4)

When: Baseline

Why: GH can affect thyroid hormone conversion

CMP

When: Baseline

Why: Liver and kidney function baseline

Lipid panel

When: Baseline

Why: GH affects lipid metabolism

๐Ÿ’ก Key Considerations
  • โ†’IGF-1 remains elevated for 6-14 days after a single injection
  • โ†’The maleimide DAC moiety is susceptible to hydrolysis in solution - use reconstituted material promptly and store refrigerated
  • โ†’Contraindication: Avoid in active cancer, diabetic retinopathy, or pituitary tumors; contraindicated with active malignancy due to IGF-1 elevation

Subscribe to unlock this content

Get free access to all content plus biweekly research updates.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for CJC-1295 DAC
How CJC-1295 DAC works at the cellular level
Key benefits and uses of CJC-1295 DAC
Overview of CJC-1295 DAC benefits and applications
Scientific Details
Molecular Formula
C165H271N47O46
Molecular Weight
3647.28 Da
CAS Number
863288-34-0
Sequence
YADAIFTQSYRKVLAQLSARKLLQDILSR-DAC

What is CJC-1295 DAC?#

CJC-1295 DAC is a synthetic 30-amino acid peptide analog of growth hormone-releasing hormone (GHRH) that incorporates a proprietary Drug Affinity Complex (DAC) technology. This modification enables the peptide to bind to serum albumin after subcutaneous injection, dramatically extending its plasma half-life from approximately 30 minutes (for the unmodified peptide) to 6 to 8 days. This prolonged duration of action allows for once-weekly dosing while maintaining sustained stimulation of growth hormone (GH) release from the anterior pituitary.

The compound was developed by ConjuChem Biotechnologies (now ConjuChem LLC) as a potential therapeutic agent for conditions associated with growth hormone deficiency. It represents a significant pharmacological advancement over native GHRH and earlier GHRH analogs, which required frequent administration due to rapid proteolytic degradation.

CJC-1295 DAC functions as a GHRH receptor agonist, stimulating the somatotroph cells of the anterior pituitary to synthesize and release growth hormone. Unlike direct GH administration, CJC-1295 DAC preserves the physiological pulsatile pattern of GH release, as it amplifies the natural GHRH signaling rather than bypassing it. This is considered pharmacologically advantageous because it maintains the hypothalamic-pituitary feedback mechanisms that regulate GH homeostasis.

Mechanism of Action#

CJC-1295 DAC activates the GHRH receptor (GHRH-R), a G protein-coupled receptor expressed on somatotroph cells in the anterior pituitary gland. Binding to the GHRH-R triggers a signaling cascade involving cyclic AMP (cAMP) and protein kinase A (PKA), which stimulates both the synthesis of growth hormone at the transcriptional level and the exocytotic release of stored GH granules.

The Drug Affinity Complex component is a maleimido derivative of lysine that forms a covalent bond with albumin in the bloodstream after injection. This albumin conjugation serves two purposes: it protects the peptide from enzymatic degradation by dipeptidyl peptidase IV (DPP-IV) and other proteases, and it dramatically increases the effective molecular size, reducing renal clearance. The result is a half-life extension from approximately 30 minutes to 6 to 8 days.

Because CJC-1295 DAC works through the natural GHRH receptor pathway, its GH-releasing effect is modulated by somatostatin, the endogenous inhibitor of GH release. This means that CJC-1295 DAC amplifies the peaks of GH secretion during the natural pulsatile cycle (particularly during sleep) without causing continuous, non-physiological GH elevation. The downstream effect includes increased hepatic production of insulin-like growth factor 1 (IGF-1), which mediates many of the anabolic and metabolic effects attributed to the GH axis.

Research Overview#

CJC-1295 DAC has been evaluated in several clinical studies, primarily Phase 1 and Phase 2 trials conducted by ConjuChem. The key clinical findings include dose-dependent increases in GH and IGF-1 levels following single and multiple subcutaneous injections, sustained IGF-1 elevation for 6 to 14 days after a single dose, and generally well-tolerated safety profiles at doses up to 120 micrograms per kilogram.

A pivotal pharmacokinetic and pharmacodynamic study published in the Journal of Clinical Endocrinology and Metabolism demonstrated that single subcutaneous doses of CJC-1295 DAC produced dose-dependent increases in mean GH concentrations (2- to 10-fold) and IGF-1 levels (1.5- to 3-fold) that persisted for up to 6 days. Multiple weekly doses over 4 to 8 weeks resulted in progressive and sustained IGF-1 elevation.

Important Considerations#

CJC-1295 DAC is an investigational compound that has not received FDA approval for any indication. While clinical trial data demonstrate its pharmacological activity, the development program was discontinued and no Phase 3 trials have been completed. The compound is available through research chemical suppliers but is not manufactured under pharmaceutical GMP conditions for human use.

The sustained elevation of GH and IGF-1 carries theoretical risks including insulin resistance, fluid retention, joint pain, and potential effects on cell proliferation. The long half-life means that any adverse effects cannot be rapidly reversed by simply discontinuing the compound. Individuals with a history of cancer, active malignancy, or conditions exacerbated by elevated GH/IGF-1 should not use this compound.

CJC-1295 DAC is prohibited by the World Anti-Doping Agency (WADA) as a growth hormone secretagogue and is banned in competitive athletics.

Key Research Findings#

Pulsatile secretion of growth hormone (GH) persists during continuous stimulation by CJC-1295, a long-acting GH-releasing hormone analog, published in Journal of Clinical Endocrinology and Metabolism (Ionescu M and Frohman LA, 2006; PMID: 17018654):

  • The study demonstrated mean GH levels increased of 46% and IGF-1 levels increased 45% one week after injection

Stay current on CJC-1295 DAC research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 130+ community reports

View community protocols

Frequently Asked Questions About CJC-1295 DAC

Where to Find CJC-1295 DAC

Research-grade suppliers verified by our scoring methodology.

View all 26 vendors โ†’

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting