Skip to main content

GDF-8

Also known as: Myostatin, Growth Differentiation Factor 8, MSTN

Research compiled by Peptide Protocol Wiki
๐Ÿ“…Updated February 9, 2026
Citations Verified
New to musculoskeletal peptides?Browse all musculoskeletal peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขKey therapeutic target for muscle wasting and muscular dystrophy
  • โ€ขInhibition produces dramatic muscle hypertrophy in animal models
  • โ€ข100% conserved mature protein across mammals, ensuring translational relevance
  • โ€ขMultiple inhibitor strategies in clinical development (antibodies, decoy receptors, follistatin)
  • โ€ขPotential metabolic benefits including reduced fat mass and improved insulin sensitivity

Community-Reported Side EffectsAnecdotal?

Protocol Quick-Reference

Muscle growth via myostatin pathway inhibition (investigational; multiple agents in clinical trials)

Dosing

Amount

Agent-dependent: MYO-029 10-30 mg/kg IV single dose; Domagrozumab 20-40 mg/kg IV q4w; Bimagrumab 70 mg SC q4w or 10 mg/kg IV q4w

Frequency

Every 2-4 weeks depending on agent

Duration

24-48 weeks in clinical trials

Administration

Route

IV

Schedule

Every 2-4 weeks depending on agent

Timing

No specific time of day; administered in clinical settings for IV agents

Cycle

Duration

24-48 weeks in clinical trials

Repeatable

Yes

Preparation & Storage

Storage: Biologic myostatin inhibitors should be stored at 2-8 degrees C (refrigerated). Do not freeze unless product labeling specifically permits it. Protect from light. Reconstituted solutions should be used within the timeframe specified in product documentation.

โš—๏ธ Suggested Bloodwork (6 tests)

DEXA scan

When: Baseline

Why: Baseline lean and fat mass measurement

Muscle MRI (if available)

When: Baseline

Why: Baseline muscle volume assessment

CBC with differential

When: Baseline

Why: Baseline blood counts

CMP

When: Baseline

Why: Liver and kidney function

CK (creatine kinase)

When: Baseline

Why: Baseline muscle enzyme

Echocardiogram

When: Baseline

Why: Baseline cardiac function; theoretical concern for cardiac hypertrophy

๐Ÿ’ก Key Considerations
  • โ†’Contraindication: Avoid in patients with cardiac disorders (theoretical hypertrophy risk); ACE-031-type agents contraindicated in patients with bleeding disorders due to BMP9/10 inhibition

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates โ€” free.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for GDF-8
How GDF-8 works at the cellular level
Key benefits and uses of GDF-8
Overview of GDF-8 benefits and applications
Scientific Details
Molecular Formula
C1237H1927N355O374S10
Molecular Weight
~25,000 Da (dimer); ~12,500 Da (monomer) Da
CAS Number
346693-49-8
Sequence
NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

What Is GDF-8 (Myostatin)?#

Growth Differentiation Factor 8, more commonly known as myostatin, is a secreted protein belonging to the transforming growth factor-beta (TGF-beta) superfamily. Myostatin functions as a potent negative regulator of skeletal muscle growth, meaning it acts as a natural brake on muscle development. The protein was discovered in 1997 by Se-Jin Lee and Alexandra McPherron at Johns Hopkins University, and the finding that its absence leads to dramatic muscle hypertrophy generated enormous scientific and therapeutic interest.

Myostatin is encoded by the MSTN gene and is produced primarily by skeletal muscle cells. It is synthesized as a 375-amino-acid precursor that undergoes proteolytic processing to release the mature, biologically active C-terminal dimer of approximately 25 kDa. The mature form circulates in the blood and signals through the activin type II receptors (ActRIIA and ActRIIB) on muscle cells, activating Smad2/3 signaling pathways that suppress muscle protein synthesis and promote protein degradation.

Biological Function#

The primary function of myostatin is to limit skeletal muscle mass. In its absence, animals develop dramatically increased muscle mass โ€” a phenotype known as "double muscling." This has been observed in myostatin-null mice, naturally occurring myostatin-deficient cattle breeds (Belgian Blue, Piedmontese), whippet dogs, sheep, and at least one documented human case. Importantly, these myostatin-deficient organisms appear generally healthy, suggesting that loss of myostatin's growth-inhibiting function does not produce catastrophic developmental defects.

Myostatin's role extends beyond simple muscle mass regulation. It also participates in:

  • Adipose tissue regulation: Myostatin inhibition reduces fat accumulation in animal models
  • Glucose metabolism: Loss of myostatin improves insulin sensitivity
  • Bone homeostasis: Interactions between muscle and bone include myostatin-mediated effects on bone density
  • Cardiac remodeling: Myostatin signaling influences cardiac hypertrophy responses

Conservation Across Species#

One of the most remarkable features of myostatin is its extraordinary conservation across evolution. The mature protein is 100% identical in amino acid sequence among human, mouse, rat, chicken, turkey, and pig, and nearly identical in many other vertebrates. This extreme conservation underscores the fundamental importance of myostatin in regulating muscle mass across the animal kingdom and also means that research in animal models is highly relevant to human biology.

Therapeutic Relevance#

Myostatin has become one of the most actively pursued therapeutic targets for muscle wasting conditions. Because myostatin inhibits muscle growth, blocking its function could potentially promote muscle growth and slow muscle loss. Therapeutic strategies targeting myostatin include:

  1. Anti-myostatin antibodies: Monoclonal antibodies that neutralize circulating myostatin (e.g., stamulumab, domagrozumab, trevogrumab)
  2. Soluble receptor decoys: ActRIIB-Fc fusion proteins that trap myostatin before it can bind its receptor (e.g., ACE-031, bimagrumab targets a related pathway)
  3. Natural antagonists: Follistatin and other proteins that bind and neutralize myostatin (AAV-follistatin gene therapy)
  4. Myostatin propeptide: The cleaved prodomain can rebind and inhibit the mature protein
  5. Antisense oligonucleotides: Targeting MSTN mRNA expression

Conditions under investigation for myostatin inhibition include Duchenne and Becker muscular dystrophies, inclusion body myositis, sarcopenia of aging, cancer cachexia, and metabolic disorders associated with muscle wasting.

Understanding GDF-8 in Context#

To understand therapeutic approaches to muscle wasting, it is essential to understand myostatin's biology, its signaling pathway, and the consequences of its inhibition. The peptides and biologics that target this pathway โ€” including follistatin, ActRIIB decoy receptors, and anti-myostatin antibodies โ€” are designed specifically to counteract myostatin's growth-inhibiting effects. This page and its companion articles provide a comprehensive overview of the science, clinical development, and risk considerations surrounding the myostatin pathway.

Key Research Findings#

Regulation of skeletal muscle mass in mice by a new TGF-beta superfamily member, published in Nature (McPherron AC et al., 1997; PMID: 9139826):

Landmark paper describing the discovery of myostatin (GDF-8) and demonstrating that myostatin-null mice exhibit dramatic increases in skeletal muscle mass.

  • Myostatin-null mice show 2-3 fold increase in muscle mass
  • Both hyperplasia (more fibers) and hypertrophy (larger fibers) contribute
  • Myostatin is expressed predominantly in skeletal muscle

Myostatin mutation associated with gross muscle hypertrophy in a child, published in New England Journal of Medicine (Schuelke M et al., 2004; PMID: 15215484):

First report of a human with loss-of-function mutations in the myostatin gene, documenting extraordinary muscular development without apparent adverse health effects.

  • Homozygous splice-site mutation in MSTN gene
  • Child exhibited extraordinary muscular development at birth
  • Mother (heterozygous carrier) was a professional athlete

A Phase I/II Trial of MYO-029 in Adult Subjects with Muscular Dystrophy, published in Annals of Neurology (Wagner KR et al., 2008; PMID: 18335515):

First clinical trial of an anti-myostatin antibody (stamulumab/MYO-029) in patients with muscular dystrophy, demonstrating safety but limited efficacy.

  • MYO-029 was safe and well-tolerated
  • No significant improvement in muscle strength or function
  • Dose-dependent trends in muscle mass observed by DEXA

Double-muscled cattle due to mutations in the myostatin gene, published in Nature Genetics (Grobet L et al., 1997; PMID: 9288100):

Identification of myostatin gene mutations as the cause of the double-muscled phenotype in Belgian Blue cattle, confirming the conserved role of myostatin across species.

  • 11-bp deletion in Belgian Blue myostatin gene
  • Multiple different myostatin mutations identified across cattle breeds
  • Confirms evolutionary conservation of myostatin function

Myostatin inhibition in muscle disease: an update on preclinical and clinical data, published in Current Opinion in Supportive and Palliative Care (Smith RC and Lin BK, 2013; PMID: 24157714):

Comprehensive review of myostatin inhibition strategies and their clinical development for muscle wasting disorders.

  • Multiple therapeutic approaches to myostatin inhibition reviewed
  • Challenges of translating preclinical results to clinical outcomes
  • Broader TGF-beta pathway considerations discussed

Stay current on GDF-8 research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 20+ community reports

View community protocols

Frequently Asked Questions About GDF-8

What is GDF-8?

GDF-8 (myostatin) is a TGF-beta superfamily protein that acts as a potent negative regulator of skeletal muscle growth. Its inhibition is a major therapeutic target for muscle wasting conditions including muscular dystrophy, sarcopenia, and cachexia.

What are the benefits of GDF-8?

Research suggests the following potential benefits of GDF-8: Key therapeutic target for muscle wasting and muscular dystrophy. Inhibition produces dramatic muscle hypertrophy in animal models. 100% conserved mature protein across mammals, ensuring translational relevance. Multiple inhibitor strategies in clinical development (antibodies, decoy receptors, follistatin). Potential metabolic benefits including reduced fat mass and improved insulin sensitivity. These findings are based on available studies and the evidence level varies across different applications.

What are the side effects of GDF-8?

Reported side effects of GDF-8 include injection site reactions, diarrhea. Most reported side effects are mild and transient. Comprehensive human safety data may be limited. Consult the detailed side effects profile for full information.

Is GDF-8 FDA approved?

GDF-8 is currently in the preclinical stage. In the United States, it is classified as investigational. No myostatin inhibitor approved by FDA; available only through clinical trials Regulations vary by country and may change.

Research protocols for GDF-8 typically use 1, 3, 10, or 30 mg/kg administered Single IV infusion for Single dose with 6-month follow-up. Dose-escalation safety study in adult muscular dystrophy patients. No standardized human dosing has been established by regulatory bodies.

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting