GDF-8: Molecular Structure
Chemical properties, amino acid sequence, and structural analysis
📌TL;DR
- •Molecular formula: C1237H1927N355O374S10
- •Molecular weight: ~25,000 Da (dimer); ~12,500 Da (monomer) Da
- •Half-life: Circulates in latent propeptide complex; active form half-life not precisely determined
Amino Acid Sequence
352 amino acids
Formula
C1237H1927N355O374S10
Molecular Weight
~25,000 Da (dimer); ~12,500 Da (monomer) Da
Half-Life
Circulates in latent propeptide complex; active form half-life not precisely determined
PDB ID
3HH2

Molecular Characterization#
Myostatin (GDF-8) is a member of the TGF-beta superfamily, sharing the characteristic cystine knot fold with other family members. The mature protein exists as a disulfide-bonded homodimer with a total molecular weight of approximately 25 kDa. Each monomer consists of 109 amino acid residues with a molecular weight of approximately 12.5 kDa.
Gene and Protein Processing#
The human MSTN gene is located on chromosome 2q32.2 and contains three exons. The gene encodes a 375-amino-acid preproprotein that undergoes sequential processing:
- Signal peptide removal: The N-terminal signal peptide (residues 1-24) is cleaved during secretion
- Prodomain cleavage: The BMP-1/tolloid family of metalloproteinases cleaves at an RSRR site (position 263-266) to separate the prodomain (latency-associated peptide, LAP) from the mature C-terminal domain
- Dimerization: Two mature monomers form a disulfide-bonded homodimer through an intermolecular disulfide bond (Cys339-Cys339)
Importantly, even after cleavage, the prodomain remains non-covalently associated with the mature dimer, maintaining myostatin in a latent complex. Full activation requires dissociation of the prodomain, which can be facilitated by BMP-1/tolloid proteinases that further degrade the LAP.
Three-Dimensional Structure#
The crystal structure of myostatin (PDB: 3HH2) reveals the canonical TGF-beta superfamily fold, characterized by:
- Cystine knot motif: Nine conserved cysteine residues form the characteristic knot, with three disulfide bonds forming a ring through which a fourth disulfide bond threads
- Finger-like projections: Two pairs of antiparallel beta-strands extend from the knot, forming a hand-like shape
- Wrist region: The alpha-helix connects the two finger pairs and is critical for receptor binding
- Convex and concave surfaces: The type II receptor binds the convex surface (knuckle), while the type I receptor engages the concave surface
The homodimer adopts a butterfly-like conformation with the two monomers oriented in an antiparallel arrangement, creating a large interface that buries approximately 1,600 square angstroms of surface area.
Receptor Binding and Signaling#
Myostatin signals through a heterotetrameric receptor complex consisting of type II and type I serine/threonine kinase receptors:
| Receptor Component | Primary Receptor | Alternative |
|---|---|---|
| Type II | ActRIIB | ActRIIA |
| Type I | ALK4 (ActRIB) | ALK5 (TbetaRI) |
The binding mechanism follows a sequential model:
- Myostatin first binds ActRIIB with high affinity (Kd approximately 5-10 nM)
- This complex then recruits the type I receptor ALK4/ALK5
- The type II receptor phosphorylates and activates the type I receptor
- Activated type I receptor phosphorylates intracellular Smad2 and Smad3
- Phospho-Smad2/3 complexes with Smad4 and translocates to the nucleus
- Nuclear Smad complexes regulate transcription of target genes including MuRF1, atrogin-1, and other muscle atrophy genes
Structure-Activity Relationships#
Several key structural features determine myostatin's biological activity:
Critical binding residues: Mutations at the type II receptor binding interface (including W281, H282, and several hydrophobic residues on the finger regions) dramatically reduce biological activity. The high conservation of these residues across species explains the 100% identity of the mature protein.
Prodomain regulation: The latency-associated peptide maintains myostatin in an inactive state. Naturally occurring mutations in livestock that affect prodomain processing or stability result in constitutive myostatin activity or inactivation depending on the specific mutation.
Disulfide architecture: The cystine knot is essential for proper folding. The ninth cysteine (unique to the TGF-beta superfamily, not present in some other cystine knot proteins) forms the interchain disulfide bond required for dimerization and biological activity.
Glycosylation: Unlike many TGF-beta superfamily members, the mature domain of myostatin is not glycosylated, though the prodomain contains N-linked glycosylation sites that may affect processing and secretion.
Comparison with Related TGF-Beta Family Members#
Myostatin shares significant structural homology with other TGF-beta family members, particularly GDF-11 (which shares 90% sequence identity in the mature domain) and activin A. These structural similarities explain why many myostatin inhibitors, including follistatin and ActRIIB-Fc, also bind these related ligands, leading to broader biological effects than pure myostatin inhibition alone.
| Property | GDF-8 (Myostatin) | GDF-11 | Activin A |
|---|---|---|---|
| Mature domain identity to GDF-8 | 100% | 90% | ~40% |
| Primary receptor | ActRIIB | ActRIIB | ActRIIB/ActRIIA |
| Tissue expression | Skeletal muscle | Broad | Broad |
| Key function | Muscle mass regulation | Aging/development | Reproductive/inflammatory |
Pharmacological Significance#
Understanding myostatin's molecular structure is critical for rational drug design. The structural basis for receptor binding has guided the development of monoclonal antibodies targeting specific epitopes, the engineering of ActRIIB-Fc decoy receptors with modified specificity, and the selection of follistatin isoforms with appropriate binding profiles. The extreme conservation of the protein also means that preclinical findings from animal models are expected to translate well to human applications.
Related Reading#
Frequently Asked Questions About GDF-8
What type of peptide is GDF-8?
GDF-8 (myostatin) is a TGF-beta superfamily protein that acts as a potent negative regulator of skeletal muscle growth. Its inhibition is a major therapeutic target for muscle wasting conditions including muscular dystrophy, sarcopenia, and cachexia.
What is the half-life of GDF-8?
The reported half-life of GDF-8 is Circulates in latent propeptide complex; active form half-life not precisely determined. Half-life can vary depending on the route of administration, formulation, and individual factors. This information is based on available preclinical or pharmacokinetic data.
What is the amino acid sequence of GDF-8?
The amino acid sequence of GDF-8 is NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS. This sequence determines its biological activity and binding properties.
Explore Further
Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer