Skip to main content
🧬Peptide Protocol Wiki

GDF-8: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Reviewed byDr. Research Team(MD (composite credential representing medical review team), PhD in Pharmacology)
📅Updated February 9, 2026
Verified

📌TL;DR

  • Molecular formula: C1237H1927N355O374S10
  • Molecular weight: ~25,000 Da (dimer); ~12,500 Da (monomer) Da
  • Half-life: Circulates in latent propeptide complex; active form half-life not precisely determined

Amino Acid Sequence

NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

352 amino acids

Formula

C1237H1927N355O374S10

Molecular Weight

~25,000 Da (dimer); ~12,500 Da (monomer) Da

Half-Life

Circulates in latent propeptide complex; active form half-life not precisely determined

PDB ID

3HH2
3D molecular structure of GDF-8
Three-dimensional representation of GDF-8
Amino acid sequence diagram for GDF-8
Color-coded amino acid sequence of GDF-8

Molecular Characterization#

Myostatin (GDF-8) is a member of the TGF-beta superfamily, sharing the characteristic cystine knot fold with other family members. The mature protein exists as a disulfide-bonded homodimer with a total molecular weight of approximately 25 kDa. Each monomer consists of 109 amino acid residues with a molecular weight of approximately 12.5 kDa.

Gene and Protein Processing#

The human MSTN gene is located on chromosome 2q32.2 and contains three exons. The gene encodes a 375-amino-acid preproprotein that undergoes sequential processing:

  1. Signal peptide removal: The N-terminal signal peptide (residues 1-24) is cleaved during secretion
  2. Prodomain cleavage: The BMP-1/tolloid family of metalloproteinases cleaves at an RSRR site (position 263-266) to separate the prodomain (latency-associated peptide, LAP) from the mature C-terminal domain
  3. Dimerization: Two mature monomers form a disulfide-bonded homodimer through an intermolecular disulfide bond (Cys339-Cys339)

Importantly, even after cleavage, the prodomain remains non-covalently associated with the mature dimer, maintaining myostatin in a latent complex. Full activation requires dissociation of the prodomain, which can be facilitated by BMP-1/tolloid proteinases that further degrade the LAP.

Three-Dimensional Structure#

The crystal structure of myostatin (PDB: 3HH2) reveals the canonical TGF-beta superfamily fold, characterized by:

  • Cystine knot motif: Nine conserved cysteine residues form the characteristic knot, with three disulfide bonds forming a ring through which a fourth disulfide bond threads
  • Finger-like projections: Two pairs of antiparallel beta-strands extend from the knot, forming a hand-like shape
  • Wrist region: The alpha-helix connects the two finger pairs and is critical for receptor binding
  • Convex and concave surfaces: The type II receptor binds the convex surface (knuckle), while the type I receptor engages the concave surface

The homodimer adopts a butterfly-like conformation with the two monomers oriented in an antiparallel arrangement, creating a large interface that buries approximately 1,600 square angstroms of surface area.

Receptor Binding and Signaling#

Myostatin signals through a heterotetrameric receptor complex consisting of type II and type I serine/threonine kinase receptors:

Receptor ComponentPrimary ReceptorAlternative
Type IIActRIIBActRIIA
Type IALK4 (ActRIB)ALK5 (TbetaRI)

The binding mechanism follows a sequential model:

  1. Myostatin first binds ActRIIB with high affinity (Kd approximately 5-10 nM)
  2. This complex then recruits the type I receptor ALK4/ALK5
  3. The type II receptor phosphorylates and activates the type I receptor
  4. Activated type I receptor phosphorylates intracellular Smad2 and Smad3
  5. Phospho-Smad2/3 complexes with Smad4 and translocates to the nucleus
  6. Nuclear Smad complexes regulate transcription of target genes including MuRF1, atrogin-1, and other muscle atrophy genes

Structure-Activity Relationships#

Several key structural features determine myostatin's biological activity:

Critical binding residues: Mutations at the type II receptor binding interface (including W281, H282, and several hydrophobic residues on the finger regions) dramatically reduce biological activity. The high conservation of these residues across species explains the 100% identity of the mature protein.

Prodomain regulation: The latency-associated peptide maintains myostatin in an inactive state. Naturally occurring mutations in livestock that affect prodomain processing or stability result in constitutive myostatin activity or inactivation depending on the specific mutation.

Disulfide architecture: The cystine knot is essential for proper folding. The ninth cysteine (unique to the TGF-beta superfamily, not present in some other cystine knot proteins) forms the interchain disulfide bond required for dimerization and biological activity.

Glycosylation: Unlike many TGF-beta superfamily members, the mature domain of myostatin is not glycosylated, though the prodomain contains N-linked glycosylation sites that may affect processing and secretion.

Myostatin shares significant structural homology with other TGF-beta family members, particularly GDF-11 (which shares 90% sequence identity in the mature domain) and activin A. These structural similarities explain why many myostatin inhibitors, including follistatin and ActRIIB-Fc, also bind these related ligands, leading to broader biological effects than pure myostatin inhibition alone.

PropertyGDF-8 (Myostatin)GDF-11Activin A
Mature domain identity to GDF-8100%90%~40%
Primary receptorActRIIBActRIIBActRIIB/ActRIIA
Tissue expressionSkeletal muscleBroadBroad
Key functionMuscle mass regulationAging/developmentReproductive/inflammatory

Pharmacological Significance#

Understanding myostatin's molecular structure is critical for rational drug design. The structural basis for receptor binding has guided the development of monoclonal antibodies targeting specific epitopes, the engineering of ActRIIB-Fc decoy receptors with modified specificity, and the selection of follistatin isoforms with appropriate binding profiles. The extreme conservation of the protein also means that preclinical findings from animal models are expected to translate well to human applications.

Frequently Asked Questions About GDF-8

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer