Skip to main content
🧬Peptide Protocol Wiki

Exenatide: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Research compiled by Peptide Protocol Wiki
📅Updated February 12, 2026
Citations Verified

📌TL;DR

  • Molecular formula: C184H282N50O60S
  • Molecular weight: 4186.6 Da
  • Half-life: 2.4 hours (Byetta); sustained release via microspheres (Bydureon)

Amino Acid Sequence

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

39 amino acids

Formula

C184H282N50O60S

Molecular Weight

4186.6 Da

Half-Life

2.4 hours (Byetta); sustained release via microspheres (Bydureon)

3D molecular structure of Exenatide
Three-dimensional representation of Exenatide
Amino acid sequence diagram for Exenatide
Color-coded amino acid sequence of Exenatide

Molecular Structure and Properties#

Exenatide is a 39-amino-acid synthetic peptide identical to exendin-4, a naturally occurring peptide isolated from the saliva of the Gila monster (Heloderma suspectum). It has a molecular weight of approximately 4,186.6 Da, with the molecular formula C184H282N50O60S and CAS number 141758-74-9. Unlike the human GLP-1 analogs (liraglutide, semaglutide), exenatide has no post-translational lipid modifications and is used in its native peptide form.

Amino Acid Sequence#

The full 39-amino-acid sequence of exenatide:

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

The sequence shares approximately 53% homology with human GLP-1(7-36)amide. Key structural features:

  • Position 1 (Histidine): Conserved from GLP-1; essential for receptor binding and activation
  • Position 2 (Glycine): Differs from GLP-1's alanine at position 2. This substitution confers natural resistance to DPP-4 cleavage, the critical enzymatic degradation that limits native GLP-1 to a 2-minute half-life. Glycine at position 2 provides steric protection against DPP-4 without requiring engineered modifications
  • Positions 1-30: Share significant structural similarity with GLP-1(7-36), particularly in the alpha-helical region critical for receptor binding (positions 11-30 correspond to the receptor interaction domain)
  • C-terminal extension (positions 31-39): GPSSGAPPPS-NH2, a nine-residue C-terminal tail not present in GLP-1. This proline-rich extension stabilizes the alpha-helical structure of the peptide and may contribute to receptor binding affinity
  • C-terminal amidation: The peptide is C-terminally amidated (PPPS-NH2), which enhances stability and receptor potency

Sequence Alignment with Human GLP-1#

PositionExenatide (Exendin-4)Human GLP-1(7-36)amideConserved?
1HisHisYes
2GlyAlaNo (DPP-4 resistance)
3GluGluYes
4GlyGlyYes
5ThrThrYes
6PhePheYes
7ThrThrYes
8SerSerYes
9AspAspYes
10LeuValNo
11SerSerYes
14GluGluYes
31-39GPSSGAPPPS(absent)No (C-terminal extension)
PropertyValueNotes
Sequence length39 amino acidsExendin-4 from Gila monster
Molecular weight~4,186.6 DaNative peptide, no lipid modification
Molecular formulaC184H282N50O60SComplete molecule
CAS number141758-74-9Registry identifier
GLP-1 homology~53%To human GLP-1(7-36)amide
DPP-4 resistanceNatural (Gly2)No engineered modification needed
C-terminusAmidated (-NH2)Stabilizes structure
Lipid modificationNoneDistinguishes from liraglutide/semaglutide

Natural DPP-4 Resistance#

The most important pharmacological feature of exendin-4 is its natural resistance to dipeptidyl peptidase-4 (DPP-4), the enzyme that rapidly inactivates native GLP-1 by cleaving the His-Ala dipeptide at the N-terminus.

In exenatide, glycine at position 2 (instead of alanine in GLP-1) provides steric protection against DPP-4 cleavage. This natural resistance extends the circulating half-life from approximately 2 minutes (native GLP-1) to approximately 2.4 hours (exenatide), a roughly 70-fold improvement without any synthetic modifications.

This represents an evolutionary adaptation: the Gila monster benefits from sustained incretin-like activity to maintain glucose homeostasis during long periods between meals (Gila monsters may eat only 5-10 times per year in the wild).

Physicochemical Properties#

Immediate-release formulation (Byetta): Clear, colorless, sterile solution for subcutaneous injection in a pre-filled pen. Formulated in a sodium acetate buffer (pH 4.5) with mannitol and metacresol as preservative.

Extended-release formulation (Bydureon BCise): White to off-white suspension containing exenatide encapsulated in poly(D,L-lactide-co-glycolide) (PLG) microspheres suspended in a medium-chain triglyceride (MCT) oil vehicle. The microspheres are approximately 0.06 mm in diameter and slowly degrade to release exenatide over weeks.

  • Solubility: Freely soluble in aqueous buffers at acidic pH
  • Stability: Byetta stable at 2-8 degrees C; Bydureon BCise stored at 2-8 degrees C, may be stored at room temperature for up to 4 weeks
  • Contains sulfur: One methionine residue contributes to the sulfur-containing molecular formula

Pharmacokinetics#

Exenatide has dramatically different pharmacokinetic profiles depending on the formulation.

Byetta (Immediate-Release)#

Absorption: After subcutaneous injection, peak plasma concentration (Cmax) is reached at approximately 2.1 hours. Bioavailability is not precisely characterized but is estimated at approximately 65-75%.

Distribution: Volume of distribution is approximately 28 liters, suggesting moderate extravascular distribution. Protein binding is moderate.

Metabolism: Exenatide is predominantly eliminated through glomerular filtration followed by proteolytic degradation in the kidney. It does not undergo CYP-mediated metabolism.

Elimination: The elimination half-life is approximately 2.4 hours. This short half-life necessitates twice-daily dosing, timed within 60 minutes before the two largest meals.

Bydureon BCise (Extended-Release Microspheres)#

Release mechanism: Exenatide is slowly released as the PLG polymer microspheres hydrolyze and degrade at the injection site. This creates a sustained-release depot.

Plasma profile: After a single injection, plasma levels initially increase slowly, reaching therapeutic concentrations over 2-6 weeks. At steady state (achieved after approximately 6-7 weeks of weekly dosing), plasma concentrations are relatively stable with low peak-to-trough variation.

Effective half-life: While the intrinsic half-life of exenatide is 2.4 hours, the microsphere formulation creates an effective release duration of approximately 1 week, enabling once-weekly dosing.

PK ParameterByetta (IR)Bydureon BCise (ER)
Tmax~2.1 hours2-6 weeks (to steady state)
Half-life (intrinsic)~2.4 hours~2.4 hours
Dosing frequencyTwice dailyOnce weekly
Meal timingRequired (60 min pre-meal)Not required
Steady state~1-2 days~6-7 weeks
Gastric emptying effectProminent (acute peaks)Attenuated (steady levels)

Receptor Pharmacology#

Exenatide is a full agonist at the GLP-1 receptor with binding affinity comparable to native GLP-1. Despite the 53% sequence homology, the conserved alpha-helical domain in the N-terminal two-thirds of the peptide is sufficient for high-affinity receptor binding and full activation of downstream signaling (primarily cAMP generation through Gs protein coupling).

Immunogenicity#

A significant pharmacological consideration with exenatide is immunogenicity. Because exenatide is based on a non-human (reptilian) peptide sequence with only 53% homology to human GLP-1, anti-drug antibodies (ADA) develop in a substantial proportion of patients:

  • Byetta: approximately 38-44% of patients develop low-titer ADA
  • Bydureon: approximately 45-64% develop ADA (higher due to sustained exposure)

In most patients, these antibodies are low-titer and do not significantly affect efficacy. However, approximately 3-5% develop high-titer antibodies associated with reduced glycemic response. This immunogenicity concern is substantially lower with human GLP-1 analogs like liraglutide (approximately 4-13% ADA) and semaglutide (<1% ADA).

  • vs. Native GLP-1(7-36)amide: Exenatide shares 53% homology and is 9 residues longer (39 vs 30 amino acids). The Gly2 substitution provides natural DPP-4 resistance. The C-terminal extension stabilizes the helical structure.
  • vs. Liraglutide: Liraglutide is a 31-amino-acid human GLP-1 analog with 97% GLP-1 homology and a C16 fatty acid for albumin binding (13-hour half-life, daily dosing). Exenatide is a non-human peptide without lipid modification.
  • vs. Semaglutide: Semaglutide is a 31-amino-acid human GLP-1 analog with Aib2 for DPP-4 resistance and C18 fatty diacid for albumin binding (7-day half-life, weekly dosing). Both achieve DPP-4 resistance but through fundamentally different approaches.
  • vs. Tirzepatide: Tirzepatide is a 39-amino-acid dual GIP/GLP-1 agonist based on the GIP sequence backbone, with a C20 fatty diacid. Both are 39 residues but have entirely different sequences and receptor profiles.

Frequently Asked Questions About Exenatide

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer