Teduglutide
Also known as: Gattex, Revestive, ALX-0600
๐TL;DR
- โข63% of patients achieved 20% or greater reduction in parenteral nutrition volume in Phase 3 STEPS trial
- โขPromotes intestinal adaptation through villus growth, crypt cell proliferation, and increased absorptive surface area
- โขLong-term treatment (up to 10 years) shows sustained reductions in parenteral nutrition requirements
- โขSome patients achieve complete enteral autonomy and independence from parenteral support
Protocol Quick-Reference
Short bowel syndrome-associated intestinal failure
Dosing
Amount
0.05 mg/kg body weight
Frequency
Once daily
Duration
Ongoing (long-term continuous treatment)
Administration
Route
SCSchedule
Once daily
Timing
Rotate injection sites daily among abdomen, thighs, and upper arms. Reconstituted solution must be used within 3 hours.
Cycle
Duration
Ongoing
Repeatable
Yes
โ๏ธ Suggested Bloodwork (4 tests)
Colonoscopy
When: Before initiation (within 6 months)
Why: Screen for colorectal polyps before starting treatment
CMP (Comprehensive Metabolic Panel)
When: Baseline and monthly initially
Why: Monitor fluid and electrolyte balance during PN optimization
Lipase and amylase
When: Baseline and if symptoms arise
Why: Monitor for pancreatitis risk
Colonoscopy
When: 1-2 years after initiation, then every 5 years
Why: Surveillance for intestinal polyps during long-term treatment
๐ก Key Considerations
- โColonoscopy required before initiation and periodically during treatment; polyps must be removed before starting
- โParenteral nutrition adjustments should not be made more frequently than every 4 weeks
- โDose reduction to 0.025 mg/kg for patients with moderate to severe renal impairment (CrCl < 50 mL/min)
Subscribe to unlock this content
Get weekly peptide research summaries, new study alerts, and protocol updates โ free.
150+ peptide profiles ยท 30+ comparisons ยท 18 research tools


Scientific Details
- Molecular Formula
- C164H252N44O55S
- Molecular Weight
- 3752 Da
- CAS Number
- 197922-42-2
- Sequence
- HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
What is Teduglutide?#
Teduglutide (marketed as Gattex in the US and Revestive in Europe) is a recombinant analog of human glucagon-like peptide-2 (GLP-2), a 33-amino acid intestinotrophic hormone that promotes growth and repair of the intestinal mucosa. It was approved by the FDA in December 2012 and by the EMA in 2012 for the treatment of adults with short bowel syndrome (SBS) who are dependent on parenteral nutrition. Pediatric approval (ages 1 year and older) followed in 2019.
Teduglutide represents a first-in-class therapy that addresses the underlying pathophysiology of intestinal failure by enhancing intestinal adaptation rather than simply managing symptoms.
Mechanism of Action#
Teduglutide binds to the GLP-2 receptor (GLP-2R), which is expressed primarily on intestinal subepithelial myofibroblasts and enteric neurons. Receptor activation triggers a cascade of downstream effects:
- Crypt cell proliferation: Stimulates intestinal stem cells and transit-amplifying cells in the crypts of Lieberkuhn, expanding the regenerative compartment
- Villus elongation: Increases villus height, thereby expanding the absorptive surface area of the small intestine
- Anti-apoptotic effects: Inhibits programmed cell death in both crypt and villus epithelial cells, prolonging the lifespan of absorptive enterocytes
- Enhanced blood flow: Increases intestinal and portal blood flow, supporting nutrient transport
- Reduced gastric emptying: Slows gastric motility, allowing more time for nutrient digestion and absorption
The GLP-2 receptor signals through subepithelial myofibroblasts to release IGF-1 and other growth factors via PI3K/Akt-dependent pathways. This indirect signaling cascade, rather than direct action on epithelial cells, explains the trophic effects on the mucosa.
Clinical Significance#
Short bowel syndrome-associated intestinal failure (SBS-IF) is a devastating condition in which patients cannot absorb sufficient nutrients from the remaining intestine after surgical resection. These patients depend on parenteral nutrition (PN), which carries significant risks including catheter-related bloodstream infections, liver disease, loss of venous access, and reduced quality of life.
Teduglutide addresses this by promoting intestinal adaptation, enabling patients to reduce or eliminate their dependence on parenteral support. In clinical trials and long-term real-world use, teduglutide has demonstrated sustained reductions in PN requirements for up to 10 years.
Important Considerations#
Teduglutide requires monitoring for potential complications including intestinal polyps, biliary and pancreatic disease, and intestinal obstruction. Colonoscopy is recommended before initiation, after 1-2 years, and then every 5 years during treatment. The drug carries a boxed warning regarding the potential acceleration of neoplastic growth.
Key Research Findings#
Teduglutide Reduces Need for Parenteral Support Among Patients with Short Bowel Syndrome with Intestinal Failure, published in Gastroenterology (Jeppesen PB et al., 2012; PMID: 22982184):
- The study demonstrated responders of 63% in teduglutide group vs 30% placebo
- The study showed mean PN volume reduction of 4.4 L/week with teduglutide vs 2.3 L/week placebo
Related Reading#
Stay current on Teduglutide research
We summarize new studies, safety updates, and dosing insights โ delivered biweekly.
Community Protocols Available
See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.
Based on 25+ community reports
View community protocolsFrequently Asked Questions About Teduglutide
Explore Further
Related Peptides
View all peptides โBPC-157
BPC-157 peptide comprehensive research guide. Covers mechanism of action (VEGF, nitric oxide, tendon healing), gut protection, musculoskeletal repair, oral vs injectable research, 2026 FDA reclassification status, safety profile, and clinical trial evidence for this gastric-derived healing peptide.
Glepaglutide
Glepaglutide (ZP1848): long-acting GLP-2 analog for short bowel syndrome. Phase 3 data shows significant parenteral support reduction. Twice-weekly dosing.
GLP-1
GLP-1: Incretin hormone powering modern weight loss drugs. Covers insulin secretion, satiety signaling, semaglutide and liraglutide data, and safety.
Larazotide
Larazotide acetate: zonulin receptor antagonist for celiac disease. Phase 2b/3 results, tight junction regulation, and intestinal permeability reduction.
Medical Disclaimer
This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.
You Might Also Like
Related content you may find interesting