Skip to main content
๐ŸงฌPeptide Protocol Wiki

Teduglutide

Also known as: Gattex, Revestive, ALX-0600

โœ“Reviewed byDr. Research Team(MD (composite credential representing medical review team), PhD in Pharmacology)
๐Ÿ“…Updated February 12, 2026
Verified
New to healing peptides?Browse all healing peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ข63% of patients achieved 20% or greater reduction in parenteral nutrition volume in Phase 3 STEPS trial
  • โ€ขPromotes intestinal adaptation through villus growth, crypt cell proliferation, and increased absorptive surface area
  • โ€ขLong-term treatment (up to 10 years) shows sustained reductions in parenteral nutrition requirements
  • โ€ขSome patients achieve complete enteral autonomy and independence from parenteral support
0:000:00

Protocol Quick-Reference

Short bowel syndrome-associated intestinal failure

Dosing

Amount

0.05 mg/kg body weight

Frequency

Once daily

Duration

Ongoing (long-term continuous treatment)

Administration

Route

SC

Schedule

Once daily

Timing

Rotate injection sites daily among abdomen, thighs, and upper arms. Reconstituted solution must be used within 3 hours.

Cycle

Duration

Ongoing

Repeatable

Yes

โš—๏ธ Suggested Bloodwork (4 tests)

Colonoscopy

When: Before initiation (within 6 months)

Why: Screen for colorectal polyps before starting treatment

CMP (Comprehensive Metabolic Panel)

When: Baseline and monthly initially

Why: Monitor fluid and electrolyte balance during PN optimization

Lipase and amylase

When: Baseline and if symptoms arise

Why: Monitor for pancreatitis risk

Colonoscopy

When: 1-2 years after initiation, then every 5 years

Why: Surveillance for intestinal polyps during long-term treatment

๐Ÿ’ก Key Considerations
  • โ†’Colonoscopy required before initiation and periodically during treatment; polyps must be removed before starting
  • โ†’Parenteral nutrition adjustments should not be made more frequently than every 4 weeks
  • โ†’Dose reduction to 0.025 mg/kg for patients with moderate to severe renal impairment (CrCl < 50 mL/min)

Subscribe to unlock this content

Get free access to all content plus biweekly research updates.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for Teduglutide
How Teduglutide works at the cellular level
Key benefits and uses of Teduglutide
Overview of Teduglutide benefits and applications
Scientific Details
Molecular Formula
C164H252N44O55S
Molecular Weight
3752 Da
CAS Number
197922-42-2
Sequence
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

What is Teduglutide?#

Teduglutide (marketed as Gattex in the US and Revestive in Europe) is a recombinant analog of human glucagon-like peptide-2 (GLP-2), a 33-amino acid intestinotrophic hormone that promotes growth and repair of the intestinal mucosa. It was approved by the FDA in December 2012 and by the EMA in 2012 for the treatment of adults with short bowel syndrome (SBS) who are dependent on parenteral nutrition. Pediatric approval (ages 1 year and older) followed in 2019.

Teduglutide represents a first-in-class therapy that addresses the underlying pathophysiology of intestinal failure by enhancing intestinal adaptation rather than simply managing symptoms.

Mechanism of Action#

Teduglutide binds to the GLP-2 receptor (GLP-2R), which is expressed primarily on intestinal subepithelial myofibroblasts and enteric neurons. Receptor activation triggers a cascade of downstream effects:

  1. Crypt cell proliferation: Stimulates intestinal stem cells and transit-amplifying cells in the crypts of Lieberkuhn, expanding the regenerative compartment
  2. Villus elongation: Increases villus height, thereby expanding the absorptive surface area of the small intestine
  3. Anti-apoptotic effects: Inhibits programmed cell death in both crypt and villus epithelial cells, prolonging the lifespan of absorptive enterocytes
  4. Enhanced blood flow: Increases intestinal and portal blood flow, supporting nutrient transport
  5. Reduced gastric emptying: Slows gastric motility, allowing more time for nutrient digestion and absorption

The GLP-2 receptor signals through subepithelial myofibroblasts to release IGF-1 and other growth factors via PI3K/Akt-dependent pathways. This indirect signaling cascade, rather than direct action on epithelial cells, explains the trophic effects on the mucosa.

Clinical Significance#

Short bowel syndrome-associated intestinal failure (SBS-IF) is a devastating condition in which patients cannot absorb sufficient nutrients from the remaining intestine after surgical resection. These patients depend on parenteral nutrition (PN), which carries significant risks including catheter-related bloodstream infections, liver disease, loss of venous access, and reduced quality of life.

Teduglutide addresses this by promoting intestinal adaptation, enabling patients to reduce or eliminate their dependence on parenteral support. In clinical trials and long-term real-world use, teduglutide has demonstrated sustained reductions in PN requirements for up to 10 years.

Important Considerations#

Teduglutide requires monitoring for potential complications including intestinal polyps, biliary and pancreatic disease, and intestinal obstruction. Colonoscopy is recommended before initiation, after 1-2 years, and then every 5 years during treatment. The drug carries a boxed warning regarding the potential acceleration of neoplastic growth.

Key Research Findings#

Teduglutide Reduces Need for Parenteral Support Among Patients with Short Bowel Syndrome with Intestinal Failure, published in Gastroenterology (Jeppesen PB et al., 2012; PMID: 22982184):

  • The study demonstrated responders of 63% in teduglutide group vs 30% placebo
  • The study showed mean PN volume reduction of 4.4 L/week with teduglutide vs 2.3 L/week placebo

Stay current on Teduglutide research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 25+ community reports

View community protocols

Frequently Asked Questions About Teduglutide

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting