Teduglutide: Molecular Structure

Molecular Structure#

Teduglutide is a 33-amino acid polypeptide with the molecular formula C164H252N44O55S and a molecular weight of approximately 3752 Da. It is produced by recombinant DNA technology in Escherichia coli and is structurally identical to native human GLP-2 except for a single amino acid substitution at position 2.

Amino Acid Sequence#

Teduglutide: H-G-D-G-S-F-S-D-E-M-N-T-I-L-D-N-L-A-A-R-D-F-I-N-W-L-I-Q-T-K-I-T-D

Native GLP-2: H-A-D-G-S-F-S-D-E-M-N-T-I-L-D-N-L-A-A-R-D-F-I-N-W-L-I-Q-T-K-I-T-D

The critical difference is at position 2: alanine (A) in native GLP-2 is replaced by glycine (G) in teduglutide. This [Gly2] substitution was specifically designed to resist cleavage by dipeptidyl peptidase-4 (DPP-4), the primary enzyme responsible for rapid inactivation of native GLP-2.

DPP-4 Resistance#

Native GLP-2 has a plasma half-life of approximately 7 minutes due to rapid N-terminal cleavage by DPP-4 at the Ala2-Asp3 bond. The glycine substitution at position 2 eliminates this cleavage site because DPP-4 cannot efficiently process substrates with glycine in the penultimate position. This extends the half-life to approximately 2-3 hours, enabling once-daily subcutaneous administration.

Chemical Properties#

Pharmacokinetic Properties#

Following subcutaneous injection, teduglutide reaches peak plasma concentrations (Tmax) in approximately 3-5 hours. The absolute bioavailability is approximately 88%, indicating efficient absorption from the injection site. The drug is eliminated primarily through renal clearance, with dose adjustment required in patients with moderate to severe renal impairment (CrCl < 50 mL/min).

Structural Comparison with GLP-2 Family#

Teduglutide belongs to the glucagon superfamily of peptide hormones, which includes glucagon, GLP-1, GLP-2, GIP, and secretin. GLP-2 is co-secreted with GLP-1 from intestinal L-cells in response to nutrient ingestion. While GLP-1 analogs (semaglutide, liraglutide) target glucose metabolism and appetite, teduglutide targets intestinal growth through the distinct GLP-2 receptor pathway.

Molecular Context#

Teduglutide belongs to the Healing category of research peptides. The molecular properties of Teduglutide determine its pharmacological behavior, including receptor binding, distribution, metabolism, and elimination. Understanding these properties is fundamental to interpreting clinical data and designing research protocols.

Structural Overview#

Teduglutide is characterized as: Teduglutide is a 33-amino acid recombinant analog of human GLP-2 with a single amino acid substitution at position 2 (Ala to Gly). This modification confers resistance to dipeptidyl peptidase-4 (DPP-4) cleavage, extending the half-life from 7 minutes to 2-3 hours while preserving full GLP-2 receptor agonist activity..

Amino Acid Sequence Details#

The amino acid sequence of Teduglutide is: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD. This sequence determines the peptide's three-dimensional structure, receptor binding properties, and biological activity.

Pharmacokinetic Profile#

Half-Life: 2-3 hours (compared to 7 minutes for native GLP-2)

The half-life of a peptide influences dosing frequency, duration of effect, and the clinical utility of the compound. Researchers should consider the half-life when designing experimental protocols.

Related Reading#

• Teduglutide overview and research guide
• Peptides similar to Teduglutide
• Teduglutide research evidence