Skip to main content

Klotho Peptides

Also known as: KP1, KP6, klotho-derived peptides, alpha-klotho peptide, klotho protein fragment

Research compiled by Peptide Protocol Wiki
๐Ÿ“…Updated March 7, 2026
Citations Verified
New to anti-aging peptides?Browse all anti-aging peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขKP1 blocks TGF-beta/TGF-beta receptor 2 engagement to inhibit kidney fibrosis in animal models
  • โ€ขKP6 disrupts Wnt/beta-catenin signaling to ameliorate diabetic kidney disease in mouse models
  • โ€ขFull-length klotho fragment (KL1) enhances cognition and synaptic plasticity in aged mice and nonhuman primates
  • โ€ขKP1 inhibits cellular senescence in fibrotic kidneys by restoring endogenous klotho expression
  • โ€ขSmall peptide format offers potential advantages over full-length klotho protein for drug development
  • โ€ขKP1 shows preferential accumulation in injured kidneys after IV administration in preclinical models

Community-Reported Side EffectsAnecdotal?

Protocol Quick-Reference

Anti-fibrotic therapy for kidney disease (preclinical)

Dosing

Amount

Not standardized (preclinical IV/infusion doses)

Frequency

Single or chronic infusion (preclinical)

Duration

Acute to multiple weeks (study-dependent)

Administration

Route

IV

Timing

KP1 administered as IV bolus in mouse fibrosis models. KP6 administered as chronic infusion in diabetic mouse models. No human dosing established.

Cycle

Duration

Study-dependent (acute to multiple weeks)

Repeatable

Single cycle

โš—๏ธ Suggested Bloodwork (3 tests)

CMP (Comprehensive Metabolic Panel)

When: Baseline

Why: Kidney and liver function baseline

Urinalysis with protein

When: Baseline

Why: Assess proteinuria relevant to kidney disease applications

Serum phosphorus and calcium

When: Baseline

Why: Klotho regulates phosphate and calcium homeostasis

๐Ÿ’ก Key Considerations
  • โ†’Preclinical only: no human clinical trials have been conducted with klotho peptides
  • โ†’KP1 and KP6 are research reagents, not pharmaceutical products or supplements
  • โ†’Full-length klotho protein cognitive effects use the much larger KL1 domain, not short KP1/KP6 peptides

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates โ€” free.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for Klotho Peptides
How Klotho Peptides works at the cellular level
Key benefits and uses of Klotho Peptides
Overview of Klotho Peptides benefits and applications
Scientific Details
Molecular Formula
C149H203N39O43
Molecular Weight
3228.42 Da
Sequence
KP1 (30 aa): FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG

What Is the Klotho Peptide?#

The klotho peptide refers to a family of synthetic fragments derived from the alpha-klotho protein, a 130 kDa transmembrane glycoprotein that functions as one of the most significant anti-aging factors identified in mammalian biology. First discovered in 1997 when its disruption in mice produced a syndrome resembling premature human aging, the alpha-klotho protein has since been linked to kidney protection, cognitive enhancement, cardiovascular health, and lifespan regulation. For a complete overview of klotho peptide research, this guide covers the two principal klotho-derived peptides (KP1 and KP6), their mechanisms, and the broader klotho protein's therapeutic potential.

The discovery was serendipitous: Makoto Kuro-o and colleagues at the University of Texas Southwestern Medical Center observed that mice with an insertional mutation in a then-unknown gene developed a constellation of age-related pathologies -- arteriosclerosis, osteoporosis, emphysema, skin atrophy, and infertility -- all by 8-9 weeks of age. They named the gene klotho after the Greek goddess Clotho, one of the three Fates who spins the thread of life. Conversely, transgenic mice overexpressing klotho lived approximately 20-30% longer than wild-type littermates, establishing klotho as one of the most robust mammalian longevity genes.

Two principal klotho-derived peptides have been characterized for therapeutic development:

  • KP1 (Klotho-Derived Peptide 1): A 30-amino-acid peptide corresponding to residues Phe57-Lys86 of human alpha-klotho. KP1 inhibits TGF-beta signaling by blocking TGF-beta receptor 2 (TbetaR2) engagement and protects against kidney fibrosis in animal models. A 2024 study further demonstrated that KP1 inhibits cellular senescence in fibrotic kidneys by restoring endogenous klotho expression.

  • KP6 (Klotho-Derived Peptide 6): A peptide that targets Wnt/beta-catenin signaling by binding to Wnt ligands and disrupting their engagement with LRP6, ameliorating diabetic kidney disease in mouse models. A variant, KP6T, has shown additional promise against vascular calcification in CKD models.

PropertyDetails
Full nameKlotho-derived peptides (KP1, KP6)
Parent proteinAlpha-klotho (1014 amino acids, ~130 kDa)
KP1 sequenceFQGTFPDGFLWAVGSAAYQTEGGWQQHGKG (30 aa)
KP1 molecular weight3,228.42 Da
Research statusPreclinical (no human trials for peptides)
Primary targetsTGF-beta receptor 2 (KP1), Wnt/LRP6 (KP6)
Key publicationsNature Communications (2022), Kidney International (2022), Nature Aging (2023)

How the Klotho Peptide Works: Mechanism of Action#

The klotho peptide exerts its effects through distinct molecular mechanisms depending on which fragment is used. Understanding how klotho peptides work requires examining both the individual peptide mechanisms and the broader signaling pathways of the parent protein.

KP1: TGF-beta Pathway Inhibition#

KP1 exerts its anti-fibrotic effects by directly binding to TGF-beta receptor type 2 (TbetaR2), which prevents TGF-beta ligands from engaging their receptor. This blocks downstream Smad2/3 phosphorylation and mitogen-activated protein kinase activation. The net effect is suppression of fibroblast activation, extracellular matrix deposition, and epithelial-mesenchymal transition, which are the hallmark processes of organ fibrosis.

In the foundational study by Yuan et al. (2022), KP1 was identified from a systematic screen of 18 overlapping peptides spanning the KL1 domain. Only KP1 demonstrated significant anti-fibrotic activity, suggesting that the specific residues Phe57-Lys86 contain a TbetaR2-binding motif that is uniquely positioned within the larger protein. When administered intravenously in mouse unilateral ureteral obstruction (UUO) models, KP1 showed preferential accumulation in injured kidneys -- a finding that suggests intrinsic tissue targeting properties, potentially mediated by increased vascular permeability or receptor density at sites of active fibrosis.

Notably, KP1 treatment also restored endogenous klotho expression in fibrotic kidneys. Since TGF-beta signaling itself suppresses klotho transcription, this creates a positive feedback loop: KP1 blocks TGF-beta, which relieves klotho suppression, which further attenuates TGF-beta signaling. A 2024 follow-up study (Yuan et al., Theranostics; PMID: 38164143) demonstrated that KP1 also inhibits cellular senescence in fibrotic kidneys by restoring klotho expression at the posttranscriptional level, expanding the therapeutic implications beyond direct anti-fibrotic activity.

KP6: Wnt/Beta-Catenin Pathway Inhibition#

KP6 acts by binding to Wnt ligands directly, preventing their engagement with the low-density lipoprotein receptor-related protein 6 (LRP6) co-receptor. This disrupts canonical Wnt/beta-catenin signaling, which is aberrantly activated in diabetic kidney disease and contributes to podocyte injury, proteinuria, and glomerulosclerosis.

The specificity of KP6 was demonstrated through a critical control experiment: a scrambled-sequence version of KP6 with identical amino acid composition but randomized order failed to bind Wnt ligands and showed no therapeutic effect. This confirmed that KP6's activity depends on its specific amino acid sequence and likely secondary structure, not merely its charge or hydrophobicity profile.

In both STZ-induced type 1 and db/db type 2 diabetic mouse models, chronic KP6 infusion reversed established proteinuria, attenuated glomerular hypertrophy, protected podocytes from injury, and ameliorated fibrotic lesions -- effects that were absent with the scrambled control peptide. A variant peptide, KP6T, has additionally been shown to block vascular calcification in CKD by inhibiting osteo-/chondrogenic transdifferentiation of vascular smooth muscle cells through Wnt/beta-catenin pathway suppression.

Klotho Protein and Cognitive Enhancement#

The full KL1 domain of alpha-klotho enhances cognition through a distinct mechanism. Systemic elevation of klotho enriches synaptic GluN2B (an NMDA receptor subunit critical for learning and memory), enhances long-term potentiation, and induces platelet-derived factors that cross the blood-brain barrier. A single low-dose injection enhanced memory in aged nonhuman primates for up to two weeks.

The cognitive effects of klotho appear to follow an inverted U-shaped dose-response curve: low doses enhance cognition while high doses do not. This pattern, replicated across mouse and nonhuman primate studies, suggests an optimal signaling window rather than a simple dose-dependent effect.

Alpha-Klotho vs Beta-Klotho: Key Differences#

Although they share a name, alpha-klotho and beta-klotho are encoded by different genes, expressed in different tissues, and serve distinct biological functions. Understanding these differences is essential for interpreting klotho peptide research.

Alpha-Klotho (KL Gene)#

Alpha-klotho is the canonical anti-aging protein. It is primarily expressed in the kidney (distal convoluted tubule), parathyroid gland, and choroid plexus of the brain. Its defining endocrine function is serving as an obligate co-receptor for fibroblast growth factor 23 (FGF23), the master regulator of phosphate homeostasis. When membrane-bound alpha-klotho forms a ternary complex with FGFR1c and FGF23, it triggers phosphaturic signaling in the kidney -- suppressing sodium-phosphate cotransporters NaPi-2a and NaPi-2c in the proximal tubule and reducing phosphate reabsorption.

Beyond its FGF23 co-receptor role, soluble alpha-klotho circulates systemically and exerts pleiotropic effects:

  • Wnt signaling inhibition: Binds Wnt ligands to suppress canonical Wnt/beta-catenin, reducing fibrosis and cellular senescence
  • Insulin/IGF-1 signaling modulation: Attenuates insulin/IGF-1 signaling through FoxO transcription factor activation, a pathway associated with longevity across species
  • TGF-beta pathway suppression: Interferes with TGF-beta receptor engagement to reduce fibrotic gene expression
  • Oxidative stress defense: Upregulates manganese superoxide dismutase (MnSOD) and catalase through FoxO activation
  • Ion channel regulation: Modifies TRPV5 calcium channel activity and ROMK potassium channels in the kidney

Beta-Klotho (KLB Gene)#

Beta-klotho is a distinct protein that serves as the co-receptor for a different subset of FGF ligands, primarily FGF21 and FGF19. It is expressed predominantly in the liver, pancreas, and adipose tissue rather than the kidney.

FeatureAlpha-KlothoBeta-Klotho
GeneKL (chromosome 13)KLB (chromosome 4)
Primary tissuesKidney, parathyroid, brainLiver, pancreas, adipose
FGF ligand partnerFGF23FGF21, FGF19
Primary functionPhosphate homeostasis, anti-agingMetabolic regulation, bile acid homeostasis
Soluble formYes (shed by ADAM10/17)Yes (shed by ADAM10/17)
Aging associationStrong (declines with age)Moderate
Therapeutic peptidesKP1, KP6None yet characterized

The FGF21/beta-klotho axis is of major therapeutic interest for metabolic disease. FGF21 acts as a metabolic hormone that enhances insulin sensitivity, promotes fatty acid oxidation, reduces hepatic lipogenesis, and may extend lifespan in animal models. Several FGF21 analogs (pegbelfermin, efruxifermin) are in clinical trials for nonalcoholic steatohepatitis (NASH), while the GLP-1/FGF21 dual agonist approach represents an emerging therapeutic strategy. However, no beta-klotho-derived peptides have been developed to date -- the current klotho peptide research focuses exclusively on alpha-klotho fragments.

FGF23 and FGF21 Signaling Pathways#

The FGF23/Alpha-Klotho Phosphate Axis#

FGF23 is a bone-derived hormone that maintains serum phosphate within a narrow physiological range. The signaling cascade requires membrane-bound alpha-klotho as an obligate co-receptor:

  1. FGF23 secretion: Osteocytes and osteoblasts secrete FGF23 in response to elevated serum phosphate, 1,25-dihydroxyvitamin D, and dietary phosphate load
  2. Ternary complex formation: FGF23 binds to the alpha-klotho/FGFR1c complex on renal tubular cells
  3. Downstream signaling: Activation of Ras/MAPK and PI3K/Akt pathways
  4. Phosphaturic effects: Downregulation of NaPi-2a/2c transporters in the proximal tubule, reducing phosphate reabsorption
  5. Vitamin D suppression: Inhibition of 1-alpha-hydroxylase (CYP27B1) and stimulation of 24-hydroxylase (CYP24A1), reducing active vitamin D levels

When klotho expression declines -- as occurs in chronic kidney disease and aging -- this system becomes dysregulated. Elevated FGF23 without adequate klotho co-receptor leads to FGF23 resistance, hyperphosphatemia, vascular calcification, and left ventricular hypertrophy. This explains why CKD patients with low klotho levels have dramatically increased cardiovascular mortality.

The FGF21/Beta-Klotho Metabolic Axis#

FGF21 signals through beta-klotho/FGFR1c complexes primarily in adipose tissue and liver:

  • Adipose tissue: FGF21 induces glucose uptake, enhances adiponectin secretion, promotes browning of white adipose tissue, and increases energy expenditure
  • Liver: Reduces hepatic lipogenesis, promotes fatty acid oxidation, and improves insulin sensitivity
  • Central nervous system: FGF21 crosses the blood-brain barrier and acts on the hypothalamus and suprachiasmatic nucleus to regulate circadian rhythm and macronutrient preference (suppressing sugar and alcohol intake in animal models)

While no beta-klotho peptides exist yet, the metabolic significance of this pathway makes it a likely future target for peptide therapeutics.

Klotho Peptide Research: Kidney Protection#

Klotho's role in kidney protection extends well beyond what the individual peptides KP1 and KP6 target. The full-length protein protects the kidney through multiple overlapping pathways, making klotho peptide research in nephrology particularly promising.

Anti-Fibrotic Effects#

Kidney fibrosis is the final common pathway of virtually all chronic kidney diseases. Klotho suppresses fibrosis through at least three mechanisms:

  • TGF-beta inhibition (replicated by KP1): Blocks TGF-beta/TbetaR2 signaling to prevent fibroblast-to-myofibroblast transition and extracellular matrix accumulation
  • Wnt inhibition (replicated by KP6): Suppresses aberrant Wnt/beta-catenin signaling that drives tubular epithelial-mesenchymal transition
  • Smad3 interference: Directly inhibits Smad3-dependent transcription of collagen and fibronectin genes

Podocyte Protection#

Podocytes -- the specialized epithelial cells of the glomerular filtration barrier -- are terminally differentiated and cannot regenerate. Their loss is a key driver of proteinuria and progressive kidney disease. Klotho protects podocytes by:

  • Inhibiting TRPC6 channel-mediated calcium influx that triggers podocyte apoptosis
  • Suppressing Wnt/beta-catenin-driven podocyte dedifferentiation
  • Maintaining nephrin and podocin expression at the slit diaphragm

Anti-Inflammatory Effects#

Chronic kidney disease is characterized by persistent low-grade inflammation. Klotho suppresses renal inflammation by:

  • Inhibiting NF-kB signaling in tubular epithelial cells
  • Reducing NLRP3 inflammasome activation
  • Attenuating macrophage infiltration and M1 polarization in the renal interstitium
  • Suppressing endothelial adhesion molecule expression

Vascular Calcification Prevention#

CKD patients develop extensive vascular calcification driven by hyperphosphatemia and klotho deficiency. Klotho prevents vascular calcification by:

  • Maintaining phosphate homeostasis through FGF23 co-receptor function
  • Directly inhibiting phosphate uptake by vascular smooth muscle cells
  • Suppressing osteogenic transdifferentiation of vascular smooth muscle cells via Wnt inhibition

Klotho Peptide and Cognitive Enhancement#

The relationship between the klotho peptide and brain function represents one of the most exciting frontiers in aging research. While the KP1 and KP6 peptides are kidney-focused, the broader klotho protein has produced compelling evidence for cognitive applications that are now entering human clinical trials.

Synaptic Plasticity Enhancement#

Klotho enhances long-term potentiation (LTP), the cellular mechanism underlying learning and memory, by increasing surface expression of GluN2B-containing NMDA receptors at hippocampal synapses. GluN2B-containing receptors produce longer excitatory postsynaptic currents than GluN2A-containing receptors, allowing greater calcium influx and stronger potentiation. Pharmacological blockade of GluN2B completely abolished klotho's cognitive-enhancing effects in transgenic mice, establishing this receptor subunit as a necessary mediator.

Neuroprotection Against Neurodegeneration#

Preclinical evidence suggests klotho may protect against multiple neurodegenerative processes:

  • Alzheimer's disease: Klotho overexpression reduced amyloid-beta burden and neuroinflammation in APP/PS1 transgenic mouse models. The KL-VS variant is associated with reduced risk of Alzheimer's disease in human genetic studies.
  • Parkinson's disease: Klotho is expressed in dopaminergic neurons of the substantia nigra, and its deficiency exacerbates oxidative stress-induced dopaminergic cell death in animal models.
  • Multiple sclerosis: Klotho promotes remyelination by enhancing oligodendrocyte precursor cell maturation and myelin repair. Studies in cuprizone and experimental autoimmune encephalomyelitis (EAE) models showed that klotho overexpression accelerated remyelination.
  • White matter integrity: The KL-VS variant is associated with greater white matter volume and microstructural integrity in human neuroimaging studies, independent of age.

Blood-Brain Barrier Considerations#

A central question in klotho neurobiology is how a peripheral protein affects brain function. Alpha-klotho (130 kDa) is too large to freely cross the blood-brain barrier. Current evidence supports two non-mutually exclusive mechanisms:

  1. Peripheral signaling relay: Klotho induces the release of blood-borne factors (including platelet factor 4) that are small enough to cross the BBB and act on hippocampal neurons
  2. Choroid plexus production: The choroid plexus expresses klotho and secretes it directly into the cerebrospinal fluid, providing a local CNS source independent of peripheral levels

First Human Clinical Trials (2025-2026)#

The klotho peptide and protein field reached a major milestone in 2025 with the initiation of the first human clinical trials. UCSF researchers began a Phase 1 trial testing klotho protein (the KL1 domain, not the small peptides) in adults over 65, measuring safety, dosing, and cognitive performance on standardized tests over a 90-day period following a single subcutaneous injection. Additionally, gene therapy approaches combining klotho with follistatin are being tested for cognitive and longevity applications. These trials represent the first direct translation of decades of preclinical klotho research into human therapeutics.

Klotho Peptide and Anti-Aging: Hallmarks Addressed#

The klotho peptide intersects with several of the recognized hallmarks of aging, making it one of the most broadly relevant anti-aging targets under investigation.

Cellular Senescence#

Klotho deficiency accelerates cellular senescence through multiple pathways, including increased p16/p21 expression, Wnt-driven senescence, and oxidative stress-induced DNA damage. KP1 has been shown to inhibit cellular senescence in fibrotic kidneys by restoring klotho expression and breaking the TGF-beta/senescence feedback loop.

Mitochondrial Dysfunction#

Klotho maintains mitochondrial function by suppressing excessive reactive oxygen species (ROS) production through FoxO-mediated upregulation of antioxidant enzymes. Klotho-deficient mice show widespread mitochondrial dysfunction with reduced membrane potential, impaired respiratory chain function, and increased mitochondrial DNA damage.

Stem Cell Exhaustion#

Klotho modulates stem cell behavior through Wnt signaling regulation. Excessive Wnt signaling depletes tissue stem cell pools, while klotho's Wnt-inhibitory activity helps maintain stem cell quiescence and self-renewal capacity. This is particularly relevant in the kidney, where tubular progenitor cells require balanced Wnt signaling for tissue repair.

Chronic Inflammation (Inflammaging)#

Age-associated chronic inflammation is both a cause and consequence of klotho decline. Klotho suppresses NF-kB-driven inflammatory gene expression, NLRP3 inflammasome activation, and endothelial dysfunction -- all of which contribute to the chronic, sterile inflammation that characterizes aging tissues.

Altered Intercellular Communication#

As an endocrine factor, soluble klotho represents a form of systemic intercellular communication that declines with age. Its loss disrupts the coordinated regulation of phosphate metabolism, Wnt signaling, insulin sensitivity, and oxidative stress defense across multiple organ systems simultaneously.

Current Clinical Status and Research Outlook#

The klotho peptide field divides into three research tracks with distinct timelines:

  1. Kidney disease: KP1 and KP6 are being developed as targeted peptide therapeutics for chronic kidney disease and diabetic kidney disease, respectively. Both have demonstrated efficacy in rodent models published in Nature Communications and Kidney International. The kidney remains the most therapeutically advanced application for the small peptides, with clear molecular targets (TbetaR2 and Wnt/LRP6) and well-defined disease models.

  2. Cognitive aging: The full klotho protein or KL1 domain has shown cognitive enhancement in mice and nonhuman primates, with the landmark 2023 Nature Aging primate study demonstrating that a single injection enhanced cognition in aged rhesus macaques. This track is now entering Phase 1 human clinical trials as of 2025.

  3. Gene therapy: Companies including Klotho Neurosciences and Minicircle are developing klotho gene therapy approaches that would enable sustained klotho expression. These represent a distinct therapeutic modality from peptide or protein administration, with early-phase trials beginning in 2025-2026.

All klotho-derived peptide research (KP1, KP6) remains preclinical. No human clinical trials have been conducted with the small peptides, though the full klotho protein has entered Phase 1 trials for cognitive enhancement.

Strategies to Naturally Support Klotho Levels#

While klotho peptides are not available for human use, several evidence-based strategies may support endogenous klotho expression:

  • Exercise: Aerobic exercise increases circulating klotho levels in human studies. Both acute bouts and chronic training programs have been associated with higher serum klotho.
  • Vitamin D: Calcitriol (1,25-dihydroxyvitamin D) upregulates klotho gene transcription in the kidney. Maintaining adequate vitamin D status may support klotho expression.
  • PPAR-gamma agonists: Thiazolidinediones (pioglitazone, rosiglitazone) increase klotho expression in animal models and CKD patients.
  • ACE inhibitors/ARBs: Renin-angiotensin system blockade with ACE inhibitors or angiotensin receptor blockers preserves renal klotho expression in CKD animal models.
  • Avoiding phosphate overload: High dietary phosphate suppresses klotho expression. Reducing processed food consumption (which is high in inorganic phosphate additives) may help preserve klotho levels.

Important Considerations#

  • Preclinical only: No klotho peptide (KP1, KP6) has been tested in humans. The full klotho protein has only recently entered Phase 1 trials.
  • Not available as supplements: Despite consumer interest in klotho as an anti-aging molecule, no klotho peptide supplements exist. Products marketed as "klotho supplements" do not contain actual klotho-derived peptides.
  • Kidney-focused peptides: KP1 and KP6 were specifically designed and tested for kidney disease, not as general anti-aging agents
  • Protein vs. peptide distinction: The cognitive enhancement effects are demonstrated with the much larger KL1 domain (approximately 450 amino acids), not with the small KP1/KP6 peptides (approximately 30 amino acids)
  • Manufacturing challenges: Recombinant klotho protein production and peptide synthesis for therapeutic use present significant challenges for clinical translation
  • Dose-response complexity: The inverted U-shaped dose-response for cognitive effects means more is not necessarily better, complicating therapeutic development

Key Research Findings#

A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-beta signaling, published in Nature Communications (Yuan Q et al., 2022; PMID: 35064106):

  • KP1 identified from screen of 18 overlapping KL1 domain peptides as the anti-fibrotic lead
  • KP1 binds TGF-beta receptor type 2 and blocks TGF-beta/TbetaR2 engagement
  • IV-injected KP1 preferentially accumulated in injured kidneys and preserved renal function
  • KP1 restored endogenous klotho expression in fibrotic kidneys, creating a positive feedback loop

Klotho-derived peptide 6 ameliorates diabetic kidney disease by targeting Wnt/beta-catenin signaling, published in Kidney International (Zhou L et al., 2022; PMID: 35644285):

  • KP6 bound Wnt ligands and disrupted Wnt/LRP6 engagement to inhibit beta-catenin signaling
  • Reversed established proteinuria in both type 1 and type 2 diabetic mouse models
  • Scrambled-sequence KP6 showed no effect, confirming sequence-specific activity

Klotho-derived peptide 1 inhibits cellular senescence in the fibrotic kidney, published in Theranostics (Yuan Q et al., 2024; PMID: 38164143):

  • KP1 inhibited cellular senescence markers (p16, p21) in fibrotic kidneys
  • Restored endogenous klotho expression via posttranscriptional regulation
  • Expanded the therapeutic scope of KP1 beyond anti-fibrotic to anti-senescence effects

Longevity factor klotho enhances cognition in aged nonhuman primates, published in Nature Aging (Castner SA et al., 2023; PMID: 37400721):

  • Single low-dose klotho injection enhanced memory in aged rhesus macaques within 4 hours
  • Effects persisted for approximately 2 weeks after a single dose
  • High-dose klotho did not enhance cognition, confirming the inverted U dose-response

Life extension factor klotho enhances cognition, published in Cell Reports (Dubal DB et al., 2014; PMID: 24813892):

  • KL-VS heterozygosity associated with enhanced cognition in humans independent of age
  • Klotho enhanced long-term potentiation and enriched synaptic GluN2B
  • GluN2B blockade abolished klotho-mediated cognitive effects

Stay current on Klotho Peptides research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 10+ community reports

View community protocols

Frequently Asked Questions About Klotho Peptides

What is the klotho peptide and how does it work?

Klotho peptides (KP1, KP6) are small synthetic fragments (approximately 30 amino acids) derived from specific regions of the 1014-amino-acid alpha-klotho protein. They replicate specific functions of the full protein, such as TGF-beta or Wnt inhibition, while being easier to manufacture and potentially deliver as drugs. KP1 targets kidney fibrosis by blocking TGF-beta receptor signaling, while KP6 targets diabetic kidney disease by disrupting Wnt/beta-catenin signaling.

What is the difference between klotho peptides and klotho protein?

Klotho peptides (KP1, KP6) are small synthetic fragments (approximately 30 amino acids) derived from specific regions of the 1014-amino-acid alpha-klotho protein. They replicate specific functions of the full protein, such as TGF-beta or Wnt inhibition, while being easier to manufacture and potentially deliver as drugs. The full klotho protein or its KL1 domain (approximately 450 amino acids) has broader biological effects but is more challenging to produce and administer.

Are klotho peptides available for human use?

No. Klotho peptides remain entirely in preclinical research. They have not been tested in human clinical trials and are not available as supplements or drugs. The peptides are available only as research reagents from specialty chemical suppliers. However, the first Phase 1 clinical trials of klotho protein (not peptides) for cognitive enhancement in older adults began in 2025.

What is the connection between klotho and aging?

The klotho gene was discovered in 1997 when its disruption in mice caused a syndrome resembling premature aging. Alpha-klotho protein levels decline with age in humans. Higher klotho levels are associated with better cognitive function, longevity, and lower risk of age-related diseases. The KL-VS genetic variant that increases klotho levels is associated with enhanced cognition and longer lifespan.

Can you increase klotho levels naturally?

Several evidence-based strategies may support endogenous klotho expression. Aerobic exercise increases circulating klotho levels in human studies. Vitamin D (calcitriol) upregulates klotho gene transcription in the kidney. PPAR-gamma agonists and ACE inhibitors or ARBs also preserve klotho expression in animal models and some clinical contexts. Reducing dietary phosphate from processed foods may also help preserve levels.

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting