Klotho Peptides: Molecular Structure
Chemical properties, amino acid sequence, and structural analysis
📌TL;DR
- •Molecular formula: C149H203N39O43
- •Molecular weight: 3228.42 Da
- •Half-life: Not established in humans. In mouse models, IV-administered KP1 showed preferential accumulation in injured kidneys. Peptide half-life in circulation has not been formally characterized.
Amino Acid Sequence
74 amino acids
Formula
C149H203N39O43
Molecular Weight
3228.42 Da
Half-Life
Not established in humans. In mouse models, IV-administered KP1 showed preferential accumulation in injured kidneys. Peptide half-life in circulation has not been formally characterized.
PDB ID
5W21

Molecular Structure#
Parent Protein: Alpha-Klotho#
The klotho-derived peptides originate from the full-length human alpha-klotho protein, a type I transmembrane glycoprotein:
| Property | Value |
|---|---|
| Gene | KL (chromosome 13q13.1) |
| Full-length protein | 1014 amino acids |
| Molecular weight | ~130 kDa (glycosylated), ~100 kDa (predicted, unglycosylated) |
| PDB structure | 5W21 (klotho-FGFR1c-FGF23 complex) |
| Domains | KL1 (~450 aa) + KL2 (~430 aa) + transmembrane (21 aa) + intracellular (10 aa) |
| Homology | Glycoside hydrolase family 1 (GH1) |
| Soluble form | ~130 kDa, shed by ADAM10/ADAM17 metalloproteinases |
| Signal peptide | Residues 1-33 (cleaved during maturation) |
| UniProt ID | Q9UEF7 |
Alpha-klotho functions as an obligate co-receptor for FGF23 in its membrane-bound form. The shed soluble form circulates in blood and cerebrospinal fluid and has distinct endocrine functions including inhibition of Wnt signaling, insulin/IGF-1 signaling modulation, and ion channel regulation.
KL1 and KL2 Domain Architecture#
KL1 Domain (Residues 34-506)#
The KL1 domain is the N-terminal extracellular domain of alpha-klotho and the source of both KP1 and KP6 peptides. It adopts a (beta/alpha)8 TIM barrel fold, the signature topology of glycoside hydrolase family 1 (GH1) enzymes. This structural classification places klotho in the same superfamily as beta-glucosidases, beta-galactosidases, and lactase-phlorizin hydrolase.
Key structural features of KL1:
- TIM barrel core: Eight parallel beta-strands surrounded by eight alpha-helices, forming a cylindrical barrel structure approximately 30 angstroms in diameter
- FGF23 binding interface: The KL1 domain contributes critical contacts to FGF23 through its loops and alpha-helical regions. The crystal structure (PDB 5W21) revealed that KL1 forms an extensive protein-protein interface with FGF23, burying approximately 900 square angstroms of surface area
- Receptor binding: KL1 also contacts FGFR1c directly, forming part of the ternary klotho-FGFR1c-FGF23 complex required for FGF23 signal transduction
- RBA motif: The receptor binding arm (RBA) in the KL1 domain extends from the TIM barrel and makes critical contacts with FGFR1c. This extension is unique to klotho and not found in canonical GH1 enzymes
- Wnt binding site: A distinct surface on KL1 mediates Wnt ligand binding, enabling the Wnt-inhibitory function of soluble klotho. KP6 derives from this region
KL2 Domain (Residues 515-953)#
The KL2 domain is the C-terminal extracellular domain. Like KL1, it adopts a GH1-like (beta/alpha)8 barrel fold, but with significant structural divergences:
- FGF23 contacts: KL2 contributes additional contacts to FGF23 binding, though less extensive than KL1. The crystal structure shows that KL2 cradles the C-terminal tail of FGF23
- Sialidase-like activity: Unlike KL1, the KL2 domain retains a modified catalytic site that can cleave terminal sialic acid residues from certain glycoproteins. This sialidase activity has been proposed to regulate ion channel function -- for example, klotho modifies the glycan moieties on TRPV5 calcium channels, exposing galectin-1 binding sites that trap the channels at the cell surface
- Interdomain linker: A flexible linker of approximately 8 residues (507-514) connects KL1 and KL2, allowing relative domain movement during receptor engagement
| Feature | KL1 Domain | KL2 Domain |
|---|---|---|
| Position | Residues 34-506 | Residues 515-953 |
| Size | ~470 amino acids | ~440 amino acids |
| Fold | (beta/alpha)8 TIM barrel | (beta/alpha)8 TIM barrel |
| GH1 catalytic activity | Absent (catalytic residues mutated) | Modified sialidase activity |
| FGF23 binding | Primary binding site | Secondary contacts (C-terminal tail) |
| Peptide derivatives | KP1 (anti-fibrotic), KP6 (anti-Wnt) | None characterized |
| Wnt binding | Yes | Minimal |
| Cognition effects | Yes (KL1 domain alone enhances cognition) | Not tested alone |
Glycoside Hydrolase Family 1 Classification#
Both KL1 and KL2 domains belong to glycoside hydrolase family 1 (GH1, EC 3.2.1.-) based on structural homology. GH1 is one of the largest glycoside hydrolase families, containing enzymes that hydrolyze glycosidic bonds in various substrates. The GH1 fold -- also called the (beta/alpha)8 or TIM barrel -- is one of the most common and versatile protein folds in nature.
However, alpha-klotho is a catalytically inactive pseudoenzyme in its KL1 domain. The canonical GH1 catalytic mechanism requires two glutamate residues (a proton donor and a nucleophile) at conserved positions within the barrel. In the KL1 domain, these catalytic glutamates are replaced by non-functional residues (Asn and Ser), abolishing hydrolytic activity. Evolution has repurposed this enzymatic scaffold into a protein-protein interaction platform -- the barrel cavity and surrounding loops now mediate binding to FGF23, FGFRs, Wnt ligands, and TGF-beta receptors.
The KL2 domain retains partial catalytic function. Its sialidase activity (alpha-2,6-sialic acid cleavage) is relatively weak compared to dedicated sialidases but is sufficient to modify glycan structures on target proteins at the cell surface.
Soluble vs Membrane-Bound Klotho#
Alpha-klotho exists in two functionally distinct forms with different biological roles:
Membrane-Bound Klotho#
The full-length transmembrane form (type I single-pass transmembrane protein) is anchored in the plasma membrane with both KL1 and KL2 domains exposed to the extracellular space, a 21-amino-acid transmembrane helix, and a short 10-amino-acid intracellular tail. Membrane-bound klotho is expressed primarily in:
- Kidney distal convoluted tubule: The highest expression level of any tissue; critical for FGF23-mediated phosphate regulation
- Parathyroid gland: Mediates FGF23 suppression of PTH secretion
- Choroid plexus: The primary site of klotho expression in the CNS; contributes to CSF klotho levels
The primary function of membrane-bound klotho is to serve as an obligate co-receptor for FGF23. Without membrane-bound klotho, FGF23 cannot activate FGFR1c in renal tubular cells, and phosphate homeostasis is disrupted. This explains why klotho-knockout mice develop severe hyperphosphatemia identical to FGF23-knockout mice.
Soluble Klotho (Shed Form)#
Soluble klotho is generated by proteolytic cleavage of the extracellular domain of membrane-bound klotho. Two metalloproteinases are responsible:
- ADAM10 (A Disintegrin and Metalloproteinase 10): Constitutive shedding; cleaves klotho near the transmembrane domain
- ADAM17 (TACE, TNF-alpha Converting Enzyme): Regulated shedding; activated by inflammatory stimuli, phorbol esters, and insulin
The shed form contains both KL1 and KL2 domains (~130 kDa) and circulates in blood and cerebrospinal fluid at concentrations of approximately 300-1000 pg/mL in healthy adults. Circulating soluble klotho functions as an endocrine hormone with effects distinct from the membrane-bound co-receptor function:
- Acts as a circulating Wnt antagonist independent of any FGFR
- Modulates insulin/IGF-1 signaling in distant tissues
- Regulates ion channels (TRPV5, ROMK) through glycan modification
- Mediates the cognitive enhancement effects observed in animal studies
Secreted Klotho (Alternative Splice Variant)#
A third form of klotho is produced by alternative mRNA splicing. This secreted form (approximately 70 kDa) contains only the KL1 domain followed by a unique 50-amino-acid C-terminal sequence not found in the membrane-bound form. The secreted form lacks the KL2 domain, transmembrane segment, and intracellular tail entirely. Its relative contribution to circulating klotho levels and its specific biological functions remain under investigation.
| Form | Size | Origin | Circulation | Key Functions |
|---|---|---|---|---|
| Membrane-bound | ~130 kDa (full-length) | Kidney, parathyroid, brain | N/A (cell surface) | FGF23 co-receptor, phosphate regulation |
| Soluble (shed) | ~130 kDa (KL1+KL2) | ADAM10/17 cleavage | Blood, CSF | Wnt inhibition, insulin modulation, cognition |
| Secreted (spliced) | ~70 kDa (KL1 only) | Alternative splicing | Blood, CSF | Under investigation |
Post-Translational Modifications#
Alpha-klotho undergoes extensive post-translational modifications that affect its function, stability, and shedding:
N-Linked Glycosylation#
Alpha-klotho is heavily N-glycosylated, with at least 8-10 predicted N-glycosylation sites (Asn-X-Ser/Thr motifs) across its extracellular domain. These glycan chains account for the difference between the predicted molecular weight (~100 kDa from amino acid sequence) and the observed molecular weight (~130 kDa on SDS-PAGE). Glycosylation is critical for:
- Protein folding and quality control: Proper glycosylation in the endoplasmic reticulum is required for correct folding and trafficking to the cell surface
- Proteolytic stability: Glycan chains protect against proteolytic degradation in the extracellular environment
- Receptor interactions: Some glycosylation sites are near the FGF23 and FGFR binding interfaces, and their glycan chains may modulate binding affinity
Proteolytic Processing (Ectodomain Shedding)#
The shedding of klotho by ADAM10 and ADAM17 is itself a regulated post-translational event. Factors that regulate shedding include:
- Insulin signaling: Insulin stimulates ADAM10/17-mediated klotho shedding, increasing circulating soluble klotho
- Inflammatory cytokines: TNF-alpha activates ADAM17, potentially as a protective response to increase soluble klotho during inflammation
- Phosphate load: High phosphate suppresses klotho gene transcription but may also affect shedding
- Angiotensin II: Promotes klotho shedding via ADAM17 activation
Phosphorylation#
The short intracellular tail (10 amino acids) contains potential phosphorylation sites, though the functional significance of intracellular phosphorylation remains poorly characterized. The tail is not required for FGF23 co-receptor function.
KP1 (Klotho-Derived Peptide 1)#
KP1 was identified through a systematic screen of 18 overlapping peptides covering the KL1 domain, each approximately 30 amino acids in length.
| Property | Value |
|---|---|
| Sequence | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG |
| Length | 30 amino acids |
| Molecular weight | ~3,228 Da |
| Position | Residues Phe57-Lys86 of human alpha-klotho |
| Domain | KL1 (N-terminal extracellular domain) |
| Structure in parent | Buried beta-strand within TIM barrel |
| Target | TGF-beta receptor type 2 (TbetaR2) |
| Mechanism | Blocks TGF-beta/TbetaR2 engagement |
| pI (predicted) | ~5.5 (weakly acidic) |
| GRAVY score | ~0.1 (slightly hydrophobic) |
The KP1 sequence contains hydrophobic residues (Phe, Leu, Trp, Val) consistent with its location as a buried beta-strand in the KL1 domain. When liberated as a free peptide, these residues may contribute to its binding affinity for TbetaR2. The presence of two tryptophan residues (Trp11 and Trp24 within the peptide) and a glycine-rich region (positions 14-16, 22-24) suggests potential for both hydrophobic receptor contacts and backbone flexibility.
KP6 (Klotho-Derived Peptide 6)#
KP6 was identified from the same systematic peptide screen as KP1 but targets a distinct signaling pathway.
| Property | Value |
|---|---|
| Length | ~30 amino acids |
| CAS number | 2102414-23-1 |
| Domain | KL1 |
| Target | Wnt ligands (Wnt1, Wnt3a, Wnt7a) |
| Mechanism | Blocks Wnt/LRP6 engagement, inhibits beta-catenin signaling |
| Position | More C-terminal within KL1 than KP1 |
KP6 derives from a region of the KL1 domain that overlaps with the Wnt ligand binding surface characterized in the full-length protein. Full-length klotho has been shown to bind multiple Wnt ligands (Wnt1, Wnt3a, Wnt4, Wnt7a) and function as a secreted Wnt antagonist. KP6 recapitulates this specific activity as a minimal peptide fragment.
A mutated KP6 with scrambled amino acid sequence failed to bind Wnt ligands and did not ameliorate diabetic kidney disease, confirming sequence-specific activity. This control experiment is critical because it demonstrates that the anti-Wnt effect requires a specific three-dimensional binding surface that depends on the native amino acid order, not merely the overall charge or amino acid composition of the peptide.
Structural Relationship to Full-Length Klotho#
The KL1 domain of alpha-klotho, from which both KP1 and KP6 are derived, has a (beta/alpha)8 barrel fold characteristic of glycoside hydrolase family 1 enzymes. However, alpha-klotho lacks key catalytic residues and does not have glycoside hydrolase activity. Instead, the GH1-like fold has been adapted for protein-protein interactions.
The crystal structure of alpha-klotho (PDB 5W21) was solved in complex with FGFR1c and FGF23 at 3.0 angstrom resolution by Chen et al. (2018), revealing the structural basis for klotho's co-receptor function. This structure showed that the KL1 and KL2 domains form a deep groove that cradles the C-terminal tail of FGF23, while the KL1 receptor binding arm (RBA) extends outward to contact the D3 domain of FGFR1c. The KP1 and KP6 peptides correspond to surface-accessible or partially buried regions of the KL1 domain that mediate distinct receptor interactions.
Structural Comparison with Full-Length Therapeutic Approaches#
| Approach | Size | Target | Manufacturing | Advantages | Limitations |
|---|---|---|---|---|---|
| KP1 peptide | 30 aa (~3.2 kDa) | TGF-beta/TbetaR2 | Solid-phase peptide synthesis | Low cost, scalable, high purity | Single target, short half-life |
| KP6 peptide | ~30 aa (~3.2 kDa) | Wnt/LRP6 | Solid-phase peptide synthesis | Low cost, scalable, high purity | Single target, short half-life |
| Soluble KL1 domain | ~450 aa (~50 kDa) | Multiple (cognition, GluN2B) | Recombinant protein expression | Broad activity, cognitive effects | Expensive production, cold chain |
| Full soluble klotho | ~950 aa (~130 kDa) | Multiple (FGF23, Wnt, TGF-beta, IGF-1) | Recombinant protein expression | Complete biological activity | Very expensive, stability challenges |
The small size of KP1 and KP6 offers practical advantages for drug development: they can be manufactured by chemical synthesis (Fmoc solid-phase peptide synthesis), are potentially more stable than larger protein fragments, may achieve better tissue penetration, and avoid the immunogenicity concerns associated with recombinant proteins. However, they replicate only specific functions of the parent protein, not its full biological activity.
Stability Considerations#
As relatively short peptides, KP1 and KP6 are susceptible to proteolytic degradation in vivo. Key stability factors include:
- Proteolytic susceptibility: Both peptides contain multiple sites for endopeptidase and exopeptidase cleavage. The glycine-rich regions in KP1 are relatively resistant to trypsin-like proteases but vulnerable to other enzymes
- Aggregation potential: The high hydrophobic content of KP1 (GRAVY ~0.1) suggests potential for self-aggregation in aqueous solution, particularly at concentrations above 1 mg/mL
- Thermal stability: As unstructured or partially structured peptides in isolation, KP1 and KP6 lack the stabilizing tertiary contacts present in the full-length protein and are expected to be thermally labile
- Tissue targeting: In the preclinical kidney studies, KP1 was administered by intravenous injection and showed preferential accumulation in injured kidneys, suggesting a degree of tissue targeting that may partially compensate for limited systemic stability. This preferential accumulation may reflect increased vascular permeability at sites of active fibrosis or specific receptor-mediated uptake
Formal pharmacokinetic characterization of either peptide has not been published. Future clinical development will likely require strategies to extend peptide half-life, such as PEGylation, lipidation, D-amino acid substitution, or formulation in sustained-release delivery systems.
Related Reading#
- Klotho Peptides overview and research guide
- Klotho Peptides dosing protocols
- Peptides similar to Klotho Peptides
- Klotho Peptides research evidence
- GHK-Cu molecular structure -- Another tissue-repair peptide with metallopeptide chemistry
- SS-31 molecular structure -- Mitochondria-targeted peptide with distinct structural design
Frequently Asked Questions About Klotho Peptides
Explore Further
Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer