Skip to main content
🧬Peptide Protocol Wiki

GLP-1: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Research compiled by Peptide Protocol Wiki
📅Updated February 9, 2026
Citations Verified

📌TL;DR

  • Molecular formula: C149H225N39O45
  • Molecular weight: 3297.7 (active form, GLP-1(7-36)amide) Da
  • Half-life: 1-2 minutes (native GLP-1; rapidly cleaved by DPP-4)

Amino Acid Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

34 amino acids

Formula

C149H225N39O45

Molecular Weight

3297.7 (active form, GLP-1(7-36)amide) Da

Half-Life

1-2 minutes (native GLP-1; rapidly cleaved by DPP-4)

PDB ID

3IOL
3D molecular structure of GLP-1
Three-dimensional representation of GLP-1
Amino acid sequence diagram for GLP-1
Color-coded amino acid sequence of GLP-1

Molecular Characterization#

GLP-1 is a peptide hormone derived from the proglucagon gene (GCG) through tissue-specific post-translational processing. The biologically active forms are GLP-1(7-36)amide (30 amino acids, C-terminally amidated) and GLP-1(7-37) (31 amino acids, free C-terminal glycine). GLP-1(7-36)amide is the predominant circulating active form, with a molecular weight of 3297.7 Da and the molecular formula C149H225N39O45.

Gene Processing and Biosynthesis#

The proglucagon gene encodes a 160-amino-acid preproglucagon precursor that is differentially processed depending on tissue:

  • Pancreatic alpha cells: Prohormone convertase 2 (PC2) produces glucagon, GRPP, IP-1, and the major proglucagon fragment
  • Intestinal L-cells: Prohormone convertase 1/3 (PC1/3) produces GLP-1, GLP-2, glicentin, oxyntomodulin, and IP-2

This tissue-specific processing means that the same gene produces the counter-regulatory hormone glucagon in the pancreas and the insulinotropic hormone GLP-1 in the gut — an elegant example of biological economy.

GLP-1(1-36)amide and GLP-1(1-37) are the initial products, but these are biologically inactive. N-terminal truncation by PC1/3 removes six amino acids to produce the active forms GLP-1(7-36)amide and GLP-1(7-37).

Three-Dimensional Structure#

The crystal structure of GLP-1 bound to its receptor (PDB: 3IOL) reveals key structural features:

  • Alpha-helical conformation: GLP-1 adopts a continuous alpha-helix from approximately residue 7 through residue 30 when bound to the receptor
  • N-terminal flexibility: Residues 7-14 are more flexible in free solution but adopt a structured conformation upon receptor engagement
  • Amphipathic character: The helix has a hydrophobic face that contacts the receptor transmembrane domain and a hydrophilic face exposed to solvent

The GLP-1 receptor belongs to the class B (secretin-like) GPCR family and features a large extracellular domain (ECD) that makes initial contact with the C-terminal portion of GLP-1, followed by engagement of the N-terminal region with the transmembrane domain core — the "two-step" binding model.

DPP-4 Degradation#

The extremely short half-life of native GLP-1 (approximately 1-2 minutes) is primarily due to cleavage by dipeptidyl peptidase-4 (DPP-4):

  • DPP-4 cleaves the His7-Ala8 bond at the N-terminus
  • The resulting GLP-1(9-36)amide is inactive at the GLP-1 receptor
  • DPP-4 is expressed on endothelial cells throughout the vasculature and as a soluble form in plasma
  • Approximately 50% of newly secreted GLP-1 is degraded before reaching the systemic circulation

This rapid degradation has been the central challenge in developing GLP-1-based therapeutics and has driven two strategies: DPP-4 inhibitors (gliptins) that protect endogenous GLP-1, and DPP-4-resistant GLP-1 receptor agonists.

Structural Basis for Therapeutic Analogs#

Each approved GLP-1 receptor agonist employs different structural strategies to overcome DPP-4 degradation:

AnalogStrategyHalf-lifeKey Modification
ExenatideNon-mammalian sequence2.4 hoursGila monster exendin-4 (53% homology)
LiraglutideAcylation13 hoursC16 fatty acid at Lys26; binds albumin
SemaglutideAcylation + backbone7 daysC18 fatty acid + Aib at position 8
DulaglutideFc fusion5 daysGLP-1 analog fused to IgG4 Fc
TirzepatideDual agonist + acylation5 daysGIP-based backbone with GLP-1R activity; C20 fatty diacid

Position 8 Modification#

Position 8 (Ala in native GLP-1) is particularly important because it is part of the DPP-4 cleavage site. Substitution with alpha-aminoisobutyric acid (Aib) in semaglutide prevents DPP-4 cleavage while maintaining receptor binding. This single modification is a key contributor to semaglutide's extended half-life.

Acylation Strategy#

Attachment of fatty acid side chains to the peptide backbone enables non-covalent binding to serum albumin, which:

  • Protects against enzymatic degradation
  • Reduces renal clearance
  • Creates an albumin-bound depot that slowly releases active peptide
  • Extends the half-life from minutes to hours (liraglutide) or days (semaglutide)

Receptor Binding and Signaling#

GLP-1 receptor activation initiates multiple intracellular signaling cascades:

  1. Gs protein coupling: Adenylyl cyclase activation, cAMP production
  2. Protein kinase A: Phosphorylation of ion channels and exocytotic machinery
  3. Epac2: cAMP-dependent but PKA-independent insulin granule exocytosis
  4. Calcium influx: Closure of K-ATP channels, membrane depolarization, calcium entry
  5. Beta-arrestin recruitment: Receptor internalization and signal diversification

The glucose-dependent nature of GLP-1's insulinotropic effect arises because many of these signaling steps require basal glucose metabolism in the beta cell to be operative. At low glucose concentrations, the K-ATP channels are already open, and GLP-1 signaling cannot generate sufficient stimulus for insulin release.

Pharmacokinetics of Native GLP-1#

ParameterValue
Fasting plasma level5-10 pmol/L
Postprandial peak15-50 pmol/L
Time to peak15-30 minutes postprandially
Plasma half-life1-2 minutes
Primary degradationDPP-4 (N-terminal cleavage)
Secondary clearanceRenal; neutral endopeptidase 24.11
Active fraction reaching circulation~50% (extensive local degradation)

Structure-Activity Relationships#

Key SAR findings for GLP-1 receptor activation:

  • His7: Essential for receptor activation; modifications at this position generally reduce potency
  • Ala8: DPP-4 cleavage site; substitution with Aib or Gly2 prevents degradation
  • Glu9, Phe12, Ile13: Important for helical stability and receptor contact
  • Positions 22-30: C-terminal region critical for initial receptor ECD recognition
  • C-terminal amidation: Enhances stability and receptor affinity compared to free acid

Frequently Asked Questions About GLP-1

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer