GLP-1: Molecular Structure
Chemical properties, amino acid sequence, and structural analysis
📌TL;DR
- •Molecular formula: C149H225N39O45
- •Molecular weight: 3297.7 (active form, GLP-1(7-36)amide) Da
- •Half-life: 1-2 minutes (native GLP-1; rapidly cleaved by DPP-4)
Amino Acid Sequence
34 amino acids
Formula
C149H225N39O45
Molecular Weight
3297.7 (active form, GLP-1(7-36)amide) Da
Half-Life
1-2 minutes (native GLP-1; rapidly cleaved by DPP-4)
PDB ID
3IOL

Molecular Characterization#
GLP-1 is a peptide hormone derived from the proglucagon gene (GCG) through tissue-specific post-translational processing. The biologically active forms are GLP-1(7-36)amide (30 amino acids, C-terminally amidated) and GLP-1(7-37) (31 amino acids, free C-terminal glycine). GLP-1(7-36)amide is the predominant circulating active form, with a molecular weight of 3297.7 Da and the molecular formula C149H225N39O45.
Gene Processing and Biosynthesis#
The proglucagon gene encodes a 160-amino-acid preproglucagon precursor that is differentially processed depending on tissue:
- Pancreatic alpha cells: Prohormone convertase 2 (PC2) produces glucagon, GRPP, IP-1, and the major proglucagon fragment
- Intestinal L-cells: Prohormone convertase 1/3 (PC1/3) produces GLP-1, GLP-2, glicentin, oxyntomodulin, and IP-2
This tissue-specific processing means that the same gene produces the counter-regulatory hormone glucagon in the pancreas and the insulinotropic hormone GLP-1 in the gut — an elegant example of biological economy.
GLP-1(1-36)amide and GLP-1(1-37) are the initial products, but these are biologically inactive. N-terminal truncation by PC1/3 removes six amino acids to produce the active forms GLP-1(7-36)amide and GLP-1(7-37).
Three-Dimensional Structure#
The crystal structure of GLP-1 bound to its receptor (PDB: 3IOL) reveals key structural features:
- Alpha-helical conformation: GLP-1 adopts a continuous alpha-helix from approximately residue 7 through residue 30 when bound to the receptor
- N-terminal flexibility: Residues 7-14 are more flexible in free solution but adopt a structured conformation upon receptor engagement
- Amphipathic character: The helix has a hydrophobic face that contacts the receptor transmembrane domain and a hydrophilic face exposed to solvent
The GLP-1 receptor belongs to the class B (secretin-like) GPCR family and features a large extracellular domain (ECD) that makes initial contact with the C-terminal portion of GLP-1, followed by engagement of the N-terminal region with the transmembrane domain core — the "two-step" binding model.
DPP-4 Degradation#
The extremely short half-life of native GLP-1 (approximately 1-2 minutes) is primarily due to cleavage by dipeptidyl peptidase-4 (DPP-4):
- DPP-4 cleaves the His7-Ala8 bond at the N-terminus
- The resulting GLP-1(9-36)amide is inactive at the GLP-1 receptor
- DPP-4 is expressed on endothelial cells throughout the vasculature and as a soluble form in plasma
- Approximately 50% of newly secreted GLP-1 is degraded before reaching the systemic circulation
This rapid degradation has been the central challenge in developing GLP-1-based therapeutics and has driven two strategies: DPP-4 inhibitors (gliptins) that protect endogenous GLP-1, and DPP-4-resistant GLP-1 receptor agonists.
Structural Basis for Therapeutic Analogs#
Each approved GLP-1 receptor agonist employs different structural strategies to overcome DPP-4 degradation:
| Analog | Strategy | Half-life | Key Modification |
|---|---|---|---|
| Exenatide | Non-mammalian sequence | 2.4 hours | Gila monster exendin-4 (53% homology) |
| Liraglutide | Acylation | 13 hours | C16 fatty acid at Lys26; binds albumin |
| Semaglutide | Acylation + backbone | 7 days | C18 fatty acid + Aib at position 8 |
| Dulaglutide | Fc fusion | 5 days | GLP-1 analog fused to IgG4 Fc |
| Tirzepatide | Dual agonist + acylation | 5 days | GIP-based backbone with GLP-1R activity; C20 fatty diacid |
Position 8 Modification#
Position 8 (Ala in native GLP-1) is particularly important because it is part of the DPP-4 cleavage site. Substitution with alpha-aminoisobutyric acid (Aib) in semaglutide prevents DPP-4 cleavage while maintaining receptor binding. This single modification is a key contributor to semaglutide's extended half-life.
Acylation Strategy#
Attachment of fatty acid side chains to the peptide backbone enables non-covalent binding to serum albumin, which:
- Protects against enzymatic degradation
- Reduces renal clearance
- Creates an albumin-bound depot that slowly releases active peptide
- Extends the half-life from minutes to hours (liraglutide) or days (semaglutide)
Receptor Binding and Signaling#
GLP-1 receptor activation initiates multiple intracellular signaling cascades:
- Gs protein coupling: Adenylyl cyclase activation, cAMP production
- Protein kinase A: Phosphorylation of ion channels and exocytotic machinery
- Epac2: cAMP-dependent but PKA-independent insulin granule exocytosis
- Calcium influx: Closure of K-ATP channels, membrane depolarization, calcium entry
- Beta-arrestin recruitment: Receptor internalization and signal diversification
The glucose-dependent nature of GLP-1's insulinotropic effect arises because many of these signaling steps require basal glucose metabolism in the beta cell to be operative. At low glucose concentrations, the K-ATP channels are already open, and GLP-1 signaling cannot generate sufficient stimulus for insulin release.
Pharmacokinetics of Native GLP-1#
| Parameter | Value |
|---|---|
| Fasting plasma level | 5-10 pmol/L |
| Postprandial peak | 15-50 pmol/L |
| Time to peak | 15-30 minutes postprandially |
| Plasma half-life | 1-2 minutes |
| Primary degradation | DPP-4 (N-terminal cleavage) |
| Secondary clearance | Renal; neutral endopeptidase 24.11 |
| Active fraction reaching circulation | ~50% (extensive local degradation) |
Structure-Activity Relationships#
Key SAR findings for GLP-1 receptor activation:
- His7: Essential for receptor activation; modifications at this position generally reduce potency
- Ala8: DPP-4 cleavage site; substitution with Aib or Gly2 prevents degradation
- Glu9, Phe12, Ile13: Important for helical stability and receptor contact
- Positions 22-30: C-terminal region critical for initial receptor ECD recognition
- C-terminal amidation: Enhances stability and receptor affinity compared to free acid
Related Reading#
Frequently Asked Questions About GLP-1
What type of peptide is GLP-1?
GLP-1 (Glucagon-Like Peptide-1) is a 30-amino-acid incretin hormone produced by intestinal L-cells that stimulates glucose-dependent insulin secretion, suppresses glucagon, slows gastric emptying, and promotes satiety. GLP-1 receptor agonists such as semaglutide and tirzepatide have transformed the treatment of type 2 diabetes and obesity.
What is the half-life of GLP-1?
The reported half-life of GLP-1 is 1-2 minutes (native GLP-1; rapidly cleaved by DPP-4). Half-life can vary depending on the route of administration, formulation, and individual factors. This information is based on available preclinical or pharmacokinetic data.
What is the amino acid sequence of GLP-1?
The amino acid sequence of GLP-1 is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2. This sequence determines its biological activity and binding properties.
Explore Further
Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer