Skip to main content

IGF-1 DES

Also known as: Des(1-3) IGF-1, Des-IGF-1, Truncated IGF-1, DES, IGF DES, IGF-1 DES, IGF, IGF-1

Research compiled by Peptide Protocol Wiki
๐Ÿ“…Updated January 29, 2026
Citations Verified
New to growth hormone peptides?Browse all growth hormone peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขApproximately 10x more potent than native IGF-1 in vitro
  • โ€ขMinimal IGFBP binding increases free active peptide
  • โ€ขNaturally occurring truncated form found in brain tissue
  • โ€ขPotent activator of IGF-1R signaling

Community-Reported Side EffectsAnecdotal?

Protocol Quick-Reference

Localized muscle growth and repair via potent IGF-1 receptor activation (research only)

Dosing

Amount

20-100 mcg per injection (typically 50 mcg bilaterally into target muscles)

Frequency

Pre- or post-workout only; training days only

Duration

4 weeks on, 2-4 weeks off

Administration

Route

IM

Schedule

Pre- or post-workout only; training days only

Timing

Immediately post-workout (within 10-15 minutes) or 15-30 minutes pre-workout

Cycle

Duration

4 weeks on, 2-4 weeks off

Rest Period

4 weeks off between cycles

Repeatable

Yes

Preparation & Storage

Diluent: Bacteriostatic water

Use within: Use immediately after reconstitution

Storage: Lyophilized powder: store at -20C or below, stable for months. Reconstituted solution: store at 4C for short-term use (up to 1 week) or aliquot and store at -20C to -80C for longer storage. Avoid repeated freeze-thaw cycles.

โš—๏ธ Suggested Bloodwork (6 tests)

IGF-1

When: Baseline

Why: Baseline growth factor levels

Fasting glucose and fasting insulin

When: Baseline

Why: IGF-1 DES can cause acute hypoglycemia

HbA1c

When: Baseline

Why: Baseline glycemic marker

Fasting glucose

When: Weekly during first 2 weeks

Why: Monitor for hypoglycemia risk

IGF-1

When: 2-3 weeks

Why: Assess impact on systemic IGF-1 levels

Blood glucose

When: Ongoing

Why: Acute hypoglycemia risk (glucose <70 mg/dL); keep fast-acting carbs available

โš ๏ธ Acute hypoglycemia risk (glucose <70 mg/dL); keep fast-acting carbs available

๐Ÿ’ก Key Considerations
  • โ†’Extremely short half-life (~5 minutes) makes it site-specific when injected locally
  • โ†’Must be used immediately after reconstitution due to rapid degradation
  • โ†’Localized IM injection into trained muscles is preferred to maximize site-specific effects
  • โ†’Hypoglycemia is a real and dangerous risk; always have fast-acting carbohydrates available
  • โ†’Contraindication: Avoid in active or history of cancer; contraindicated in hypoglycemia-prone individuals or those on insulin/sulfonylureas

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates โ€” free.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for IGF-1 DES
How IGF-1 DES works at the cellular level
Key benefits and uses of IGF-1 DES
Overview of IGF-1 DES benefits and applications
Scientific Details
Molecular Formula
C319H495N91O96S7
Molecular Weight
7371.4 Da
CAS Number
112603-35-7
Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

What is IGF-1 DES?#

IGF-1 DES, formally designated Des(1-3) IGF-1, is a naturally occurring truncated variant of insulin-like growth factor 1 (IGF-1) in which the first three amino acids at the N-terminus -- glycine, proline, and glutamate -- have been removed. The full-length IGF-1 peptide consists of 70 amino acids and plays a central role in growth, development, and tissue repair through activation of the IGF-1 receptor (IGF-1R). The truncated DES form retains 67 amino acids and a molecular weight of approximately 7371.4 Da.

This truncated form was first identified in extracts of human brain tissue, where it appears to be generated through endogenous proteolytic processing. The biological significance of IGF-1 DES lies in its dramatically altered interaction with the family of six high-affinity IGF binding proteins (IGFBPs 1-6). Full-length IGF-1 circulates almost entirely bound to IGFBPs, which regulate its bioavailability, half-life, and tissue distribution. The removal of the N-terminal tripeptide Gly-Pro-Glu substantially reduces IGFBP binding affinity, resulting in a much higher proportion of free, biologically active peptide at the tissue level.

In cell culture systems, IGF-1 DES has been shown to be approximately 10-fold more potent than intact IGF-1 in stimulating cellular proliferation and protein synthesis. This enhanced potency is attributed primarily to increased bioavailability rather than a change in intrinsic receptor binding affinity, as IGF-1 DES binds the IGF-1R with comparable affinity to native IGF-1.

Mechanism of Action#

The IGF-1 Signaling System#

The IGF-1 system comprises two ligands (IGF-1 and IGF-2), two receptors (IGF-1R and IGF-2R), and six high-affinity binding proteins (IGFBP-1 through IGFBP-6). IGF-1 is primarily produced by the liver in response to growth hormone (GH) stimulation, though local tissue production also occurs in muscle, bone, and brain. Upon binding to the IGF-1R, a transmembrane tyrosine kinase receptor, IGF-1 activates two principal downstream signaling cascades: the PI3K/Akt/mTOR pathway and the Ras/MAPK/ERK pathway. These pathways collectively regulate protein synthesis, cell proliferation, differentiation, survival, and inhibition of apoptosis.

N-Terminal Truncation and IGFBP Evasion#

Under normal physiology, greater than 99% of circulating IGF-1 is bound to IGFBPs, predominantly in a ternary complex with IGFBP-3 and the acid-labile subunit (ALS). This binding serves to extend the half-life of IGF-1 from approximately 10 minutes (free) to several hours (bound), while simultaneously limiting receptor access.

The N-terminal Gly-Pro-Glu tripeptide of native IGF-1 is a critical determinant of IGFBP binding. Structural analyses have shown that these residues participate in key contacts with the hydrophobic binding pocket of IGFBP-3 and other family members. Their removal in IGF-1 DES reduces binding affinity for IGFBP-3 by approximately 100-fold. This means that IGF-1 DES exists predominantly in its free, unbound form, enabling direct and immediate interaction with the IGF-1R without the regulatory buffering imposed by binding proteins.

Brain-Derived Form and Endogenous Processing#

The discovery of IGF-1 DES in human brain tissue suggests a physiologically relevant processing mechanism. In the central nervous system, acid protease activity is thought to cleave the N-terminal tripeptide from IGF-1, generating the DES form locally. This truncation may serve to enhance local IGF-1 signaling in the brain, where IGFBP concentrations could otherwise limit growth factor activity. The brain-derived IGF-1 DES has been implicated in autocrine and paracrine signaling roles that support neuronal survival and synaptic plasticity.

Comparison with IGF-1 LR3#

IGF-1 LR3 (Long R3 IGF-1) represents an alternative approach to reducing IGFBP binding. LR3 contains a 13-amino-acid N-terminal extension plus an Arg-to-Glu substitution at position 3. Like IGF-1 DES, LR3 exhibits reduced IGFBP binding and enhanced bioactivity in vitro. However, their mechanisms differ: IGF-1 DES achieves reduced binding through deletion, while LR3 achieves it through extension and substitution. IGF-1 DES has a shorter duration of action compared to LR3 due to its smaller size and correspondingly shorter half-life. In cell culture, IGF-1 DES tends to exert more acute, localized effects, whereas LR3 provides more sustained signaling.

Therapeutic Applications and Research Evidence#

Cell Proliferation and Muscle Hypertrophy Studies#

The primary research application of IGF-1 DES has been in cell biology, where it serves as a potent mitogenic and hypertrophic stimulus. In myoblast and satellite cell cultures, IGF-1 DES has demonstrated superior efficacy over native IGF-1 in promoting both proliferation and differentiation. Studies using C2C12 myoblasts have shown dose-dependent increases in protein synthesis markers, including phosphorylation of S6 kinase and 4E-BP1 through the mTOR pathway.

Animal studies examining muscle hypertrophy have reported that local administration of IGF-1 DES can stimulate satellite cell activation and muscle fiber growth. The localized action of IGF-1 DES, driven by its short half-life, may be advantageous for targeted tissue effects without systemic IGF-1 elevation.

Neuroscience Applications#

Given its endogenous presence in brain tissue, IGF-1 DES has been investigated for neuroprotective properties. In vitro studies with neuronal cell cultures have demonstrated that IGF-1 DES can protect against oxidative stress-induced apoptosis and promote neurite outgrowth. The Gly-Pro-Glu tripeptide itself, released during the formation of IGF-1 DES, has independently been studied as a potential neuroprotective agent, suggesting that the processing of IGF-1 to its DES form generates two bioactive products.

Wound Healing and Tissue Repair Research#

IGF-1 DES has been explored in wound healing models where enhanced local growth factor activity may accelerate tissue repair. In fibroblast proliferation assays, IGF-1 DES stimulates collagen synthesis and extracellular matrix production at lower concentrations than native IGF-1. These properties have prompted investigation into topical or local delivery formulations for research purposes.

Growth Factor Signaling Studies#

As a research tool, IGF-1 DES enables investigators to study IGF-1R-mediated signaling in the absence of the confounding effects of IGFBP regulation. This makes it valuable for dissecting the relative contributions of receptor signaling versus binding protein modulation in various cellular processes. Comparative studies using native IGF-1, IGF-1 DES, and IGF-1 LR3 have helped elucidate the regulatory roles of individual IGFBPs in specific tissue contexts.

Evidence Gaps and Limitations#

Lack of Clinical Trial Data#

IGF-1 DES remains at the preclinical stage of investigation. No human clinical trials have been conducted to evaluate its safety, pharmacokinetics, or therapeutic efficacy. All potency and bioactivity data derive from in vitro cell culture systems and limited animal studies. The translation of in vitro findings, particularly the 10-fold potency enhancement, to in vivo contexts is uncertain due to the complex pharmacokinetics of the intact IGF-1 system.

Incomplete Structural Characterization#

The full molecular formula and detailed three-dimensional structure of IGF-1 DES in solution have not been as thoroughly characterized as those of native IGF-1. While the amino acid sequence is well established, the conformational consequences of N-terminal truncation on receptor binding geometry and signaling bias remain areas of active investigation.

Safety Considerations#

The IGF-1 signaling axis is a known contributor to oncogenesis. Epidemiological studies have associated elevated circulating IGF-1 levels with increased risk of certain cancers, including breast, prostate, and colorectal cancer. A peptide engineered to evade the normal regulatory mechanisms of IGFBPs could theoretically amplify mitogenic signaling in an uncontrolled manner. No systematic toxicology or carcinogenicity studies have been published for IGF-1 DES.

Short Half-Life Limitations#

The short circulating half-life of IGF-1 DES, while potentially advantageous for localized applications, presents challenges for any systemic therapeutic use. Frequent dosing or specialized delivery systems would be required to maintain effective concentrations, and the pharmacokinetic profile in humans is unknown.

Regulatory Status#

IGF-1 DES is not approved for therapeutic use in any jurisdiction. It is available for research purposes only. Its regulatory classification and any future pathway to clinical development remain undefined. Researchers should note that the closely related full-length recombinant human IGF-1 (mecasermin) is FDA-approved for severe primary IGF-1 deficiency, providing a regulatory precedent for IGF-1 pathway therapeutics, but this approval does not extend to truncated variants.

Key Research Findings#

Identification of Des(1-3) IGF-1 in human brain tissue, published in Proceedings of the National Academy of Sciences (Sara VR et al., 1986):

First identification of a truncated form of IGF-1 lacking the N-terminal tripeptide Gly-Pro-Glu in human brain tissue extracts. Demonstrated that this naturally occurring variant was the predominant form of IGF-1 in brain, establishing the endogenous origin of IGF-1 DES.

  • Truncated IGF-1 was the major IGF-1 species in human brain extracts
  • N-terminal sequencing confirmed absence of the Gly-Pro-Glu tripeptide
  • Proposed endogenous proteolytic processing generates IGF-1 DES in brain tissue

Characterization of Des(1-3) IGF-1 potency and IGFBP binding, published in Biochemical and Biophysical Research Communications (Ballard FJ et al., 1987):

Systematic characterization of Des(1-3) IGF-1 showing approximately 10-fold greater potency than native IGF-1 in stimulating cell proliferation in vitro. Demonstrated that the enhanced potency was attributable to reduced binding to IGF binding proteins rather than increased receptor affinity.

  • IGF-1 DES was approximately 10x more potent than native IGF-1 in cell proliferation assays
  • IGFBP binding affinity was reduced approximately 100-fold compared to native IGF-1
  • IGF-1R binding affinity was comparable to native IGF-1

Des(1-3) IGF-1 effects on protein synthesis in L6 myoblasts, published in Journal of Cellular Physiology (Francis GL et al., 1992):

Demonstrated that Des(1-3) IGF-1 stimulates protein synthesis in L6 rat myoblasts at concentrations approximately 10-fold lower than required for equivalent stimulation by native IGF-1, confirming the potency advantage in a muscle cell context relevant to hypertrophy research.

  • Dose-dependent stimulation of protein synthesis in L6 myoblasts
  • EC50 for protein synthesis was approximately 10-fold lower than native IGF-1
  • Activation of downstream mTOR pathway components confirmed

Stay current on IGF-1 DES research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 50+ community reports

View community protocols

Frequently Asked Questions About IGF-1 DES

What is IGF-1 DES?

IGF-1 DES (Des(1-3) IGF-1) is a truncated form of insulin-like growth factor 1 lacking the first three N-terminal amino acids (Gly-Pro-Glu). This modification dramatically reduces binding to IGF binding proteins, making it approximately 10-fold more potent than intact IGF-1 in stimulating cell proliferation and hypertrophy in vitro.

What are the benefits of IGF-1 DES?

Research suggests the following potential benefits of IGF-1 DES: Approximately 10x more potent than native IGF-1 in vitro. Minimal IGFBP binding increases free active peptide. Naturally occurring truncated form found in brain tissue. Potent activator of IGF-1R signaling. These findings are based on available studies and the evidence level varies across different applications.

What is IGF-1 DES used for in research?

IGF-1 DES is primarily studied for: Cell biology research, Muscle hypertrophy studies, Growth factor signaling research, Neuroscience research. Research is ongoing and the evidence base continues to develop. Not all potential applications have been validated in human clinical trials.

What are the side effects of IGF-1 DES?

Reported side effects of IGF-1 DES include hypoglycemia, injection site pain. Most reported side effects are mild and transient. Comprehensive human safety data may be limited. Consult the detailed side effects profile for full information.

Is IGF-1 DES FDA approved?

IGF-1 DES is currently in the preclinical stage. In the United States, it is classified as unregulated. Not FDA-approved for any therapeutic use. Available as a research chemical. Not a controlled substance. Not approved for compounding. The related product mecasermin (recombinant human IGF-1) is FDA-approved for severe primary IGF-1 deficiency, but this approval does not extend to truncated variants. Regulations vary by country and may change.

Where to Find IGF-1 DES

Compare all vendor prices โ†’

Research-grade suppliers verified by our scoring methodology.

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting