Skip to main content
🧬Peptide Protocol Wiki

IGF-1 DES: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Reviewed byDr. Research Team(MD (composite credential representing medical review team), PhD in Pharmacology)
📅Updated January 29, 2026
Verified

📌TL;DR

  • Molecular formula: C319H495N91O96S7
  • Molecular weight: 7371.4 Da
  • Half-life: Short (estimated minutes, due to small size and lack of IGFBP binding)

Amino Acid Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

67 amino acids

Formula

C319H495N91O96S7

Molecular Weight

7371.4 Da

Half-Life

Short (estimated minutes, due to small size and lack of IGFBP binding)

3D molecular structure of IGF-1 DES
Three-dimensional representation of IGF-1 DES
Amino acid sequence diagram for IGF-1 DES
Color-coded amino acid sequence of IGF-1 DES

Molecular Structure and Identity#

IGF-1 DES, formally designated Des(1-3) IGF-1, is a truncated form of human insulin-like growth factor 1 (IGF-1) consisting of 67 amino acids. The parent molecule, full-length IGF-1, is a 70-amino-acid single-chain polypeptide with three intramolecular disulfide bonds. IGF-1 DES lacks the first three N-terminal residues -- glycine (Gly), proline (Pro), and glutamate (Glu) -- yielding a molecular weight of approximately 7371.4 Da compared to the 7649 Da of intact IGF-1. The CAS registry number for IGF-1 DES is 112603-35-7.

The truncation preserves the overall three-dimensional fold of IGF-1, which adopts a compact structure stabilized by three disulfide bridges: Cys6-Cys48, Cys18-Cys61, and Cys47-Cys52 (numbered relative to the full-length sequence). These disulfide bonds organize the peptide into a characteristic insulin-family fold consisting of three alpha-helical segments connected by loop regions. The B domain, C domain, and A domain architecture that IGF-1 shares with insulin and IGF-2 remains intact in the DES variant, as the excised tripeptide resides upstream of the first structured helix.

N-Terminal Truncation and Functional Consequences#

The removal of the Gly-Pro-Glu tripeptide from the N-terminus represents a structurally conservative but functionally transformative modification. Structural studies of full-length IGF-1 bound to IGF binding proteins (IGFBPs) have demonstrated that the N-terminal residues form critical contacts with the hydrophobic binding cleft of IGFBP-3 and other family members. Specifically, the Glu3 side chain participates in electrostatic interactions and hydrogen bonding with IGFBP residues that stabilize the IGF-1/IGFBP complex.

The loss of these three residues reduces IGFBP-3 binding affinity by approximately 100-fold. This reduction extends across the family of six high-affinity IGFBPs (IGFBP-1 through IGFBP-6), though the magnitude of binding reduction varies among individual members. The consequence is that IGF-1 DES exists predominantly in its free, unbound state in biological systems, rather than sequestered in the ternary complex of IGF-1/IGFBP-3/acid-labile subunit (ALS) that normally carries more than 99% of circulating IGF-1.

Importantly, the N-terminal truncation does not significantly alter the affinity of IGF-1 DES for the IGF-1 receptor (IGF-1R). The receptor-binding determinants of IGF-1 are located primarily in the B and A domains, particularly residues in helical segments that contact the L1 and CRD domains of the IGF-1R extracellular region. Because these determinants are preserved, IGF-1 DES binds IGF-1R with comparable affinity to native IGF-1, and the approximately 10-fold increase in biological potency observed in vitro is attributed to enhanced bioavailability rather than altered intrinsic receptor affinity.

Brain-Derived Natural Form#

IGF-1 DES was first identified as a naturally occurring peptide in extracts of human brain tissue. The truncation is believed to result from endogenous proteolytic processing by acid proteases that cleave the Glu3-Thr4 peptide bond of full-length IGF-1. This processing generates two bioactive products: the truncated IGF-1 DES peptide and the released Gly-Pro-Glu (GPE) tripeptide, which has independently been investigated as a neuroprotective agent.

The presence of IGF-1 DES in brain tissue suggests a physiological mechanism for enhancing local IGF-1 signaling in the central nervous system, where IGFBP concentrations might otherwise limit growth factor activity. In the brain microenvironment, the generation of a free, unbound form of IGF-1 could facilitate more rapid and direct activation of IGF-1R on neurons, glia, and other neural cell types, supporting autocrine and paracrine signaling for neuronal survival and synaptic plasticity.

IGF-1 Receptor Binding and Downstream Signaling#

Upon binding the IGF-1R, a transmembrane receptor tyrosine kinase, IGF-1 DES activates the same two principal signaling cascades as native IGF-1. The PI3K/Akt/mTOR pathway drives protein synthesis, cell growth, and anti-apoptotic signaling through phosphorylation of downstream effectors including S6 kinase (S6K1), 4E-BP1, and BAD. The Ras/MAPK/ERK pathway promotes cell proliferation, differentiation, and gene expression changes.

IGF-1 DES also binds the insulin receptor (IR) and IGF-2 receptor (IGF-2R/mannose-6-phosphate receptor), though with lower affinity than for IGF-1R. The affinity for the insulin receptor is approximately 100-fold lower than for IGF-1R, but at high local concentrations -- which are more likely with IGF-1 DES due to its free state -- cross-activation of the insulin receptor can occur, contributing to hypoglycemic effects.

Physicochemical Properties and Stability#

PropertyValueNotes
Molecular weight~7371.4 Da67 amino acids
CAS number112603-35-7Registry identifier
Disulfide bonds3 (Cys6-Cys48, Cys18-Cys61, Cys47-Cys52)Numbered per full-length IGF-1 sequence
Isoelectric point (theoretical)~8.5Basic pI similar to native IGF-1
Parent moleculeHuman IGF-1 (70 amino acids, MW ~7649 Da)Truncation removes 3 N-terminal residues
IGFBP-3 bindingReduced ~100-fold vs native IGF-1Primary functional consequence of truncation
IGF-1R affinityComparable to native IGF-1Receptor-binding determinants preserved

As a peptide of moderate size, IGF-1 DES is susceptible to proteolytic degradation in serum and tissues. The absence of IGFBP binding, while enhancing bioavailability, simultaneously removes the protective effect that binding protein complexation provides against circulating proteases. Full-length IGF-1 in the ternary complex with IGFBP-3 and ALS has a circulating half-life of approximately 12-16 hours, whereas free IGF-1 has a half-life of roughly 10 minutes. IGF-1 DES, which cannot form these protective complexes, is expected to have a similarly short or shorter circulating half-life in the range of minutes, though precise pharmacokinetic parameters in humans have not been established.

Pharmacokinetic Considerations#

No formal pharmacokinetic studies of IGF-1 DES have been conducted in humans. Extrapolation from the known pharmacokinetics of free IGF-1 and from the structural characteristics of IGF-1 DES suggests the following profile:

  • Absorption: rapid following subcutaneous or intramuscular injection, consistent with its moderate molecular weight and solubility
  • Distribution: expected to distribute broadly due to the absence of IGFBP sequestration, with rapid tissue penetration
  • Metabolism: proteolytic degradation in serum and tissues, with the peptide likely cleaved into smaller fragments and ultimately amino acids
  • Elimination: renal filtration of intact peptide and metabolites, given the molecular weight below the typical glomerular filtration threshold for peptides

The short duration of action implied by these properties means that IGF-1 DES exerts acute, localized effects rather than sustained systemic signaling. This characteristic distinguishes it from IGF-1 LR3, which has reduced IGFBP binding but a longer half-life due to its larger size (83 amino acids, MW ~9111 Da) and partial IGFBP interactions.

Structural Comparison with IGF-1 Variants#

VariantLengthMW (Da)N-terminal ModificationIGFBP BindingRelative Potency (in vitro)
Native IGF-170 aa~7649NoneFull binding1x (reference)
IGF-1 DES67 aa~7371Gly-Pro-Glu deletion~100-fold reduced~10x
IGF-1 LR383 aa~911113-aa extension + Arg3Glu substitutionMarkedly reduced~3-10x
IGF-267 aa~7471Different sequenceBinds IGFBPs 2,5,6 preferentiallyLower at IGF-1R

Evidence Gaps in Structural Characterization#

The three-dimensional solution structure of IGF-1 DES has not been determined independently by NMR or X-ray crystallography. Structural inferences are based on the well-characterized structure of native IGF-1 (PDB entries available) and the assumption that loss of three N-terminal residues upstream of the first alpha helix does not substantially alter the folded core. The conformational consequences of N-terminal truncation on receptor-binding geometry, particularly any subtle changes in the orientation of B-domain residues at the IGF-1R interface, remain an area of active investigation. Additionally, the full molecular formula has not been consistently reported in the literature, though it can be derived from the established amino acid sequence.

Frequently Asked Questions About IGF-1 DES

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer