Skip to main content
🧬Peptide Protocol Wiki

Retatrutide: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Reviewed byDr. Research Team(MD (composite credential representing medical review team), PhD in Pharmacology)
📅Updated January 29, 2026
Verified

📌TL;DR

  • Molecular formula: C221H342N46O68
  • Molecular weight: 4731.41 Da
  • Half-life: Approximately 6 days

Amino Acid Sequence

His(Aib)QGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C18 fatty acid at Lys30

69 amino acids

Formula

C221H342N46O68

Molecular Weight

4731.41 Da

Half-Life

Approximately 6 days

3D molecular structure of Retatrutide
Three-dimensional representation of Retatrutide
Amino acid sequence diagram for Retatrutide
Color-coded amino acid sequence of Retatrutide

Investigational Status Notice#

Retatrutide (LY3437943) is an investigational compound developed by Eli Lilly and Company. It has not been approved by the FDA or any other regulatory agency for clinical use. All structural and pharmacological information presented here is derived from published preclinical and Phase 1-2 clinical trial data. This compound is currently available only through participation in clinical trials.

Molecular Structure and Properties#

Retatrutide (LY3437943) is a synthetic peptide of approximately 39 amino acids, representing the first-in-class triple incretin receptor agonist. Its molecular formula is C228H350N48O66, with a molecular weight of approximately 4,894.58 Da. The assigned CAS registry number is 2381089-83-2. The molecule was rationally designed by Eli Lilly scientists to simultaneously engage three G-protein-coupled receptors central to metabolic homeostasis: the glucose-dependent insulinotropic polypeptide (GIP) receptor, the glucagon-like peptide-1 (GLP-1) receptor, and the glucagon receptor.

The structural architecture of retatrutide reflects sophisticated peptide engineering. The backbone is primarily built on a GIP receptor agonist scaffold, which was then systematically modified to introduce cross-reactivity at the GLP-1 and glucagon receptors. This multi-target design represents a significant advance beyond both the single-agonist GLP-1 receptor agonists (such as semaglutide) and the dual GIP/GLP-1 agonists (such as tirzepatide).

Amino Acid Sequence#

The primary sequence of retatrutide contains approximately 39 amino acid residues with the general structure: His-(Aib)-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2, with a C18 fatty diacid moiety conjugated through a linker at the Lys30 position. The C-terminus is amidated, which contributes to enhanced metabolic stability and reduced susceptibility to carboxypeptidase degradation.

Several key sequence features underpin the triple receptor agonist activity of the molecule:

  • Position 1 (Histidine): The N-terminal histidine residue is critically important for glucagon receptor activation. In native glucagon, the His1 residue participates directly in receptor binding and signal transduction at the glucagon receptor. Retention of this unmodified histidine in retatrutide preserves potent glucagon receptor agonism, which is a defining structural distinction compared to tirzepatide, where this position is also histidine but the molecule lacks meaningful glucagon receptor activity due to other sequence differences.

  • Position 2 (Alpha-aminoisobutyric acid, Aib): The substitution of the natural amino acid at position 2 with the non-natural alpha-aminoisobutyric acid (Aib) residue is a well-established strategy for conferring resistance to dipeptidyl peptidase-4 (DPP-4) cleavage. DPP-4 is a serine protease that rapidly inactivates endogenous GLP-1 and GIP by cleaving the N-terminal His-Ala dipeptide. The Aib substitution introduces a gem-dimethyl group on the alpha-carbon, creating steric hindrance that prevents DPP-4 from accessing the scissile bond. This modification is shared with tirzepatide and other modern incretin analogs, and is essential for achieving the extended duration of action required for once-weekly dosing.

  • GIP backbone scaffold: The overall sequence of retatrutide is derived primarily from the GIP peptide backbone. This provides high-affinity GIP receptor binding as the foundational pharmacological activity. Specific residues throughout the mid-region of the peptide (approximately positions 12-29) were selected and optimized to maintain GIP receptor potency while simultaneously enabling interactions with the GLP-1 and glucagon receptors.

  • C-terminal region: The C-terminal segment, including residues such as Trp, Leu, Val, and the Lys-Gly-Arg-NH2 terminus, contributes to receptor binding interactions and provides the attachment site for the fatty acid modification.

Fatty Acid Modification#

A defining structural feature of retatrutide is the C18 (octadecanedioic acid) fatty diacid moiety conjugated at Lys30 via a chemical linker. This lipidation strategy serves multiple pharmacokinetic purposes:

  • Albumin binding: The C18 fatty acid chain binds reversibly to serum albumin in the bloodstream. Human serum albumin has a plasma half-life of approximately 19 days, and by hitching to this abundant plasma protein, retatrutide achieves a dramatically extended circulating half-life compared to the unmodified peptide. The resulting elimination half-life of approximately 6 days supports convenient once-weekly subcutaneous dosing.

  • Reduced renal clearance: The large hydrodynamic radius of the albumin-retatrutide complex reduces glomerular filtration, further extending plasma residence time.

  • Depot effect at the injection site: The fatty acid moiety promotes self-association and interaction with subcutaneous tissue components at the injection site, creating a slow-release depot that contributes to sustained absorption after subcutaneous administration.

The choice of a C18 fatty acid in retatrutide contrasts with the C20 (eicosanedioic acid) fatty diacid used in tirzepatide. This difference in acyl chain length may influence the albumin binding affinity and pharmacokinetic profile. Additionally, the point of fatty acid attachment differs: retatrutide uses Lys30, whereas tirzepatide is acylated at Lys20. These distinct conjugation sites reflect the different peptide backbones and the optimization required to maintain triple versus dual receptor activity while accommodating the lipid modification.

Structural Comparison with Tirzepatide#

The structural relationship between retatrutide and tirzepatide warrants detailed comparison, as both are multi-receptor incretin agonists developed by Eli Lilly:

FeatureRetatrutide (LY3437943)Tirzepatide (LY3298176)
Receptor targetsGIP + GLP-1 + Glucagon (triple)GIP + GLP-1 (dual)
Peptide length~39 amino acids39 amino acids
Position 2Aib (DPP-4 resistance)Aib (DPP-4 resistance)
Backbone scaffoldGIP-basedGIP-based
Fatty acid typeC18 fatty diacidC20 fatty diacid
Fatty acid attachmentLys30Lys20
Glucagon receptor activityPotent agonistNegligible
N-terminal His contributionPreserved for glucagon activityPresent but glucagon activity minimal
Approximate molecular weight~4,894 Da~4,810 Da
Half-life~6 days~5 days
Dosing frequencyOnce weeklyOnce weekly

The most pharmacologically consequential structural difference is the engineering of glucagon receptor agonism into retatrutide. This was achieved through careful selection of amino acid residues, particularly in the N-terminal region centered around the unmodified His1, and through optimization of the mid-chain and C-terminal regions to simultaneously support binding at all three receptors. The glucagon receptor component is expected to provide unique metabolic effects including increased energy expenditure and enhanced hepatic lipid oxidation, which may contribute to the substantial body weight reductions observed in Phase 2 clinical trials.

Pharmacokinetics#

The pharmacokinetic profile of retatrutide has been characterized in Phase 1 and Phase 2 clinical trials, revealing properties consistent with its structural design for once-weekly subcutaneous administration. As an investigational compound, the full pharmacokinetic characterization remains ongoing.

  • Absorption: Following subcutaneous injection, retatrutide is absorbed gradually from the injection depot, reaching peak plasma concentrations (Tmax) at approximately 12-72 hours post-dose. The slow absorption is facilitated by the C18 fatty acid modification promoting local tissue interactions and self-association.

  • Distribution: Once in systemic circulation, retatrutide is extensively bound to albumin through its C18 fatty diacid moiety. This albumin binding is the primary determinant of the large apparent volume of distribution and extended half-life. The bound fraction limits free peptide availability but provides a sustained release of active molecule.

  • Metabolism: Like other peptide therapeutics, retatrutide is expected to be degraded through general proteolytic pathways rather than hepatic cytochrome P450 metabolism. The Aib residue at position 2 and the fatty acid modification both confer resistance to the primary degradation enzymes (DPP-4 and neprilysin), extending the metabolic half-life.

  • Elimination: The terminal elimination half-life is approximately 6 days, supporting once-weekly dosing. Steady-state plasma concentrations are reached after approximately 4-5 weekly doses. The renal clearance is limited by the large albumin-bound complex, with proteolytic degradation being the primary elimination pathway.

  • Dose proportionality: Phase 1 data suggest approximately dose-proportional pharmacokinetics across the tested dose ranges, with predictable accumulation upon repeated weekly dosing.

Physicochemical Properties#

PropertyValue
Molecular formulaC228H350N48O66
Molecular weight~4,894.58 Da
CAS number2381089-83-2
Peptide length~39 amino acids
C-terminal modificationAmidated (-NH2)
Position 2 substitutionAlpha-aminoisobutyric acid (Aib)
Lipid modificationC18 fatty diacid at Lys30
ClassificationSynthetic peptide, lipidated
SolubilityAqueous-soluble formulation for SC injection
StoragePer investigational protocol (not publicly specified)

Receptor Binding and Signaling#

The triple agonist activity of retatrutide produces a unique pharmacological profile. In preclinical characterization studies (Coskun et al., 2022, Molecular Metabolism), retatrutide demonstrated potent agonist activity at all three target receptors:

  • GIP receptor: High-potency agonism derived from the GIP backbone scaffold. GIP receptor activation enhances glucose-dependent insulin secretion, promotes pancreatic beta-cell survival, and may contribute to improved lipid metabolism.

  • GLP-1 receptor: Agonism at the GLP-1 receptor provides appetite suppression through central hypothalamic and brainstem signaling, delays gastric emptying, and enhances glucose-dependent insulin secretion. This receptor is the primary target of established therapies including semaglutide and liraglutide.

  • Glucagon receptor: The glucagon receptor agonism is the defining feature that differentiates retatrutide from all currently approved incretin-based therapies. Glucagon receptor activation stimulates hepatic glucose production, increases hepatic lipid oxidation and fatty acid beta-oxidation, and promotes thermogenesis and energy expenditure. While glucagon receptor agonism alone could raise blood glucose levels, this effect is counterbalanced by the simultaneous GLP-1 and GIP receptor activation, which enhance insulin secretion and glucose disposal. The net metabolic result is a favorable glucose profile combined with increased energy expenditure and enhanced hepatic fat clearance.

The balanced engagement of these three receptors distinguishes retatrutide from other investigational and approved therapies in the incretin class. The integration of glucagon-mediated energy expenditure with the appetite-suppressive and insulinotropic effects of GIP and GLP-1 agonism is hypothesized to explain the substantial weight loss and metabolic improvements observed in Phase 2 trials. However, as an investigational compound, the full characterization of retatrutide's receptor pharmacology and its translation to long-term clinical outcomes remains to be established through ongoing Phase 3 clinical trials.

Frequently Asked Questions About Retatrutide

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer