Skip to main content
🧬Peptide Protocol Wiki

Liraglutide: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Reviewed byDr. Research Team(MD (composite credential representing medical review team), PhD in Pharmacology)
📅Updated February 12, 2026
Verified

📌TL;DR

  • Molecular formula: C172H265N43O51
  • Molecular weight: 3751.2 Da
  • Half-life: Approximately 13 hours

Amino Acid Sequence

H-AEGTFTSDVSSYLEGQAAKEFIAWLVRGRG with Arg34 and C16 fatty acid at Lys26

71 amino acids

Formula

C172H265N43O51

Molecular Weight

3751.2 Da

Half-Life

Approximately 13 hours

3D molecular structure of Liraglutide
Three-dimensional representation of Liraglutide
Amino acid sequence diagram for Liraglutide
Color-coded amino acid sequence of Liraglutide

Molecular Structure and Properties#

Liraglutide is a 31-amino-acid synthetic peptide analog of human glucagon-like peptide-1 (GLP-1), developed by Novo Nordisk. It has a molecular weight of approximately 3,751.2 Da, with the molecular formula C172H265N43O51 and CAS number 204656-20-2. Liraglutide was the first acylated GLP-1 analog to achieve once-daily dosing through fatty acid-mediated albumin binding, establishing the design principle later refined in semaglutide.

Amino Acid Sequence#

The primary structure of liraglutide is based on the native human GLP-1(7-37) sequence with 97% homology. Two modifications distinguish it from the native peptide:

His-Ala-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG

with a C16 fatty acid (palmitic acid) moiety conjugated at the lysine residue at position 26 via a glutamic acid spacer.

Key residues and their functional significance:

  • Position 1 (Histidine): Retained from native GLP-1; essential for GLP-1 receptor binding and activation
  • Position 2 (Alanine): Retained as native alanine, unlike semaglutide which substitutes Aib at this position. This means liraglutide retains susceptibility to DPP-4 cleavage, though the albumin binding substantially reduces the rate of enzymatic degradation
  • Position 26 (Lysine): Serves as the conjugation site for the C16 fatty acid (palmitic acid), attached through a glutamic acid spacer. This fatty acid modification is the primary mechanism for half-life extension
  • Position 34 (Arginine): Replaces native lysine at position 34. This substitution prevents unwanted fatty acid conjugation at this site, ensuring the C16 chain attaches exclusively at Lys26
PropertyValueNotes
Sequence length31 amino acidsBased on GLP-1(7-37)
Molecular weight~3,751.2 DaIncluding C16 fatty acid
Molecular formulaC172H265N43O51Complete molecule
CAS number204656-20-2Registry identifier
Sequence homology97% to human GLP-1One substitution (Arg34)
Lipid modificationC16 fatty acid at Lys26Via glutamic acid spacer
C-terminusFree acidGLP-1(7-37) form

Lipid Modification and Albumin Binding#

The C16 fatty acid (palmitic acid) conjugated at Lys26 is the defining pharmacokinetic feature of liraglutide. This modification serves several purposes:

  1. Albumin binding: The palmitic acid moiety binds non-covalently to serum albumin (>98% bound in plasma), creating a circulating depot that protects the peptide from renal filtration and proteolytic degradation. This extends the half-life from approximately 2 minutes (native GLP-1) to approximately 13 hours, enabling once-daily dosing.

  2. Linker design: The connection between the peptide backbone at Lys26 and the palmitic acid uses a single glutamic acid spacer. This is a simpler linker design compared to the gamma-glutamic acid and mini-PEG linker used in semaglutide.

  3. Self-association: At pharmaceutical concentrations, liraglutide forms heptameric complexes in solution, which further slows absorption from the subcutaneous injection site and contributes to the sustained pharmacokinetic profile.

Comparison with Semaglutide's Lipid Modification#

The evolution from liraglutide's C16 fatty acid to semaglutide's C18 fatty diacid illustrates progressive pharmacokinetic optimization:

  • Chain length: Liraglutide uses C16 (palmitic acid) versus semaglutide's C18 (octadecanedioic acid). The longer chain provides stronger albumin binding affinity.
  • Linker complexity: Liraglutide uses a simple glutamic acid spacer, while semaglutide uses a gamma-glutamic acid plus mini-PEG linker. The mini-PEG improves aqueous solubility.
  • Half-life outcome: Liraglutide achieves approximately 13 hours (daily dosing), while semaglutide achieves approximately 7 days (weekly dosing).
  • DPP-4 resistance: Semaglutide adds an Aib substitution at position 2 for DPP-4 resistance, which liraglutide lacks.

Physicochemical Properties#

Liraglutide is formulated as a clear, colorless solution for subcutaneous injection in a phosphate buffer at pH 8.15, with disodium phosphate dihydrate, propylene glycol, phenol as preservative, and hydrochloric acid/sodium hydroxide for pH adjustment.

  • Solubility: Freely soluble in aqueous buffers at physiological pH
  • Stability: Stable at 2-8 degrees C for the shelf life; pens may be stored at room temperature (up to 30 degrees C) for up to 30 days after first use
  • Self-association: Forms zinc-free heptamers in solution at pharmaceutical concentrations

Pharmacokinetics#

Liraglutide exhibits predictable pharmacokinetics across the approved dose range.

Absorption: After subcutaneous injection, maximum plasma concentration is reached at approximately 8-12 hours post-dose. Absolute bioavailability after subcutaneous administration is approximately 55%.

Distribution: The apparent volume of distribution is approximately 11-17 liters. The high degree of albumin binding (>98%) limits extravascular distribution.

Metabolism: Liraglutide is endogenously metabolized through general protein catabolism. It is not a substrate for a specific organ as the route of elimination, and intact liraglutide is not detected in urine or feces.

Elimination: The elimination half-life is approximately 13 hours, supporting once-daily dosing. Clearance is approximately 1.2 L/hr. Steady-state concentrations are achieved after approximately 3-5 days of daily dosing.

PK ParameterValueNotes
Tmax8-12 hoursSubcutaneous injection
Bioavailability (SC)~55%Subcutaneous administration
Vd~11-17 LPrimarily vascular compartment
Protein binding>98%Albumin binding
Half-life~13 hoursSupports daily dosing
Clearance~1.2 L/hrMetabolic elimination
Time to steady state~3-5 daysWith daily dosing

Receptor Pharmacology#

Liraglutide is a selective GLP-1 receptor agonist with no clinically meaningful activity at the GIP receptor, glucagon receptor, or other related receptors. Its receptor binding affinity is comparable to native GLP-1. Unlike semaglutide, liraglutide does not have the Aib2 substitution that provides DPP-4 resistance, but the albumin binding effectively compensates by reducing the rate of enzymatic exposure.

  • vs. Native GLP-1(7-37): Liraglutide retains 97% sequence homology with only the Arg34 substitution and the C16 fatty acid conjugation. Half-life extended from approximately 2 minutes to approximately 13 hours.
  • vs. Semaglutide: Both are acylated GLP-1 analogs, but semaglutide uses a C18 diacid with mini-PEG linker and Aib2 substitution, achieving a 7-day half-life (weekly dosing) versus liraglutide's 13-hour half-life (daily dosing). Semaglutide provides greater clinical efficacy.
  • vs. Exenatide: Exenatide (exendin-4) is a 39-amino-acid peptide from Gila monster venom with 53% homology to human GLP-1. It has no lipid modification and a 2.4-hour half-life (twice-daily dosing for Byetta).
  • vs. Tirzepatide: Tirzepatide is a 39-amino-acid dual GIP/GLP-1 agonist with a C20 fatty diacid, providing both dual receptor activation and weekly dosing.

Frequently Asked Questions About Liraglutide

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer