Skip to main content
🧬Peptide Protocol Wiki

Tirzepatide: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Research compiled by Peptide Protocol Wiki
📅Updated January 29, 2026
Citations Verified

📌TL;DR

  • Molecular formula: C225H348N48O68
  • Molecular weight: 4813.45 Da
  • Half-life: Approximately 5 days

Amino Acid Sequence

Y(Aib)EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C20 fatty diacid at Lys20

69 amino acids

Formula

C225H348N48O68

Molecular Weight

4813.45 Da

Half-Life

Approximately 5 days

3D molecular structure of Tirzepatide
Three-dimensional representation of Tirzepatide
Amino acid sequence diagram for Tirzepatide
Color-coded amino acid sequence of Tirzepatide

Molecular Structure and Properties#

Tirzepatide (LY3298176) is a 39-amino-acid synthetic peptide engineered as a first-in-class dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist. It was developed by Eli Lilly and Company and has a molecular weight of approximately 4,813.45 Da, with the molecular formula C225H348N48O68 and CAS number 2023788-19-2. Tirzepatide represents a novel approach to metabolic therapeutics, combining activity at two incretin receptors within a single molecule.

Amino Acid Sequence#

The primary structure of tirzepatide is a 39-amino-acid linear peptide based on the native human GIP(1-42) sequence, with specific modifications to confer dual receptor activity, enzymatic resistance, and prolonged duration of action. The sequence is:

Y-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

with a C20 fatty diacid moiety conjugated at the lysine residue at position 20 via a gamma-glutamic acid-based linker.

Key residues and their functional significance include:

  • Position 1 (Tyrosine): Retained from native GIP; critical for receptor engagement at both GIPR and GLP-1R.
  • Position 2 (Alpha-aminoisobutyric acid, Aib): This non-natural amino acid replaces the native alanine at position 2, conferring resistance to dipeptidyl peptidase-4 (DPP-4) cleavage. DPP-4 is a serine protease that rapidly inactivates native GIP and GLP-1 by removing the N-terminal dipeptide, resulting in half-lives of only minutes for the endogenous hormones. The Aib substitution sterically hinders DPP-4 from recognizing and cleaving the N-terminus.
  • Positions 12 and 13: Modified from native GIP to introduce GLP-1 receptor cross-reactivity. The substitutions at these positions, along with other sequence changes, allow tirzepatide to engage GLP-1R with therapeutically meaningful potency despite the GIP-based backbone.
  • Position 14 (Glutamic acid): Contributes to GLP-1R binding affinity.
  • Position 20 (Lysine): Serves as the conjugation site for the C20 fatty diacid moiety, which is attached through a gamma-glutamic acid (gamma-Glu) spacer and a mini-polyethylene glycol linker. This lipidation is essential for albumin binding and the resulting prolonged half-life.
  • C-terminal amidation (-NH2): The peptide chain terminates with a C-terminal amide group rather than a free carboxylic acid, which enhances metabolic stability and is a common modification in therapeutic peptides.

The overall design philosophy uses the GIP backbone to maintain high-affinity GIPR activation while incorporating specific amino acid substitutions that introduce GLP-1R agonism. In vitro studies demonstrate that tirzepatide activates GIPR with approximately 5-fold greater potency than native GIP, while at GLP-1R it shows approximately 0.02-fold the potency of native GLP-1, though this reduced potency is compensated by the high plasma concentrations achieved clinically.

PropertyValueNotes
Sequence length39 amino acidsLinear peptide
Molecular weight~4,813.45 DaIncluding C20 fatty diacid
Molecular formulaC225H348N48O68Complete molecule
CAS number2023788-19-2Registry identifier
Non-natural residueAib at position 2DPP-4 resistance
Lipid modificationC20 fatty diacid at Lys20Via gamma-Glu linker
C-terminusAmidated (-NH2)Enhanced stability
Backbone originGIP(1-42) sequenceModified for dual activity

Lipid Modification and Albumin Binding#

The C20 fatty diacid (eicosanedioic acid) conjugated at Lys20 is a defining structural feature of tirzepatide. This modification serves multiple pharmacological purposes:

  1. Albumin binding: The fatty diacid moiety binds non-covalently to serum albumin (binding >99%), creating a circulating depot that shields the peptide from renal filtration and proteolytic degradation. This extends the half-life from minutes (unmodified peptide) to approximately 5 days, enabling once-weekly subcutaneous dosing.

  2. Linker architecture: The connection between the peptide backbone at Lys20 and the fatty diacid employs a gamma-glutamic acid spacer coupled with a hydrophilic mini-PEG element. This linker design balances the lipophilicity needed for albumin binding with sufficient aqueous solubility for formulation and subcutaneous depot absorption.

  3. Pharmacokinetic optimization: The albumin-bound tirzepatide circulates as a slow-release reservoir. Free peptide dissociates from albumin to engage target receptors, while the albumin-bound fraction maintains steady-state plasma concentrations with low peak-to-trough variability across the weekly dosing interval.

This lipidation strategy is conceptually related to the C18 fatty diacid used in semaglutide, though tirzepatide employs a longer C20 chain and a different linker architecture, contributing to its distinct pharmacokinetic profile.

Physicochemical Properties#

Tirzepatide is formulated as a clear, colorless to slightly yellow solution for subcutaneous injection. Key physicochemical characteristics include:

  • Solubility: Formulated in an aqueous phosphate buffer at pH 4.5, with sodium chloride as tonicity agent and suitable preservatives.
  • Stability: The formulation is stable under refrigerated conditions (2-8 degrees C) and for limited periods at controlled room temperature (up to 30 degrees C for 21 days).
  • Isoelectric point: The theoretical pI is in the range of approximately 4.5-5.0, reflecting the balance of acidic and basic residues in the sequence. The multiple glutamic acid and aspartic acid residues contribute to a net negative charge at physiological pH.

Pharmacokinetics#

Tirzepatide exhibits predictable, dose-proportional pharmacokinetics across the clinically used dose range (2.5 mg to 15 mg weekly subcutaneous injection).

Absorption: After subcutaneous injection, tirzepatide is absorbed relatively slowly due to its lipidated nature and albumin-binding properties. The time to maximum plasma concentration (Tmax) ranges from approximately 8 to 72 hours post-injection, with a median of approximately 24 hours. Absolute bioavailability after subcutaneous administration is approximately 80%.

Distribution: The apparent volume of distribution at steady state is approximately 10.3 liters, which is consistent with distribution primarily in the vascular compartment due to extensive albumin binding (>99%). The high degree of protein binding limits extravascular distribution and contributes to the prolonged half-life.

Metabolism: Tirzepatide is metabolized through proteolytic cleavage of the peptide backbone, beta-oxidation of the C20 fatty diacid moiety, and amide hydrolysis. Importantly, tirzepatide does not undergo clinically meaningful metabolism by cytochrome P450 (CYP) enzymes, and therefore CYP-mediated drug-drug interactions are not expected. The metabolites are not pharmacologically active at GIPR or GLP-1R.

Elimination: The elimination half-life is approximately 5 days (approximately 117 hours), supporting once-weekly dosing. Clearance is approximately 0.061 L/hr. Tirzepatide is primarily eliminated through metabolic degradation; no single organ is the predominant route of elimination. Steady-state concentrations are typically achieved after 4 weeks (4 doses) of once-weekly administration.

PK ParameterValueNotes
Tmax8-72 hours (median ~24 h)Subcutaneous injection
Bioavailability~80%Subcutaneous administration
Vd (steady state)~10.3 LPrimarily vascular compartment
Protein binding>99%Albumin binding
Half-life~5 days (117 h)Supports weekly dosing
Clearance~0.061 L/hrMetabolic elimination
Time to steady state~4 weeksWith weekly dosing
CYP metabolismNot significantCYP-independent
Active metabolitesNone identifiedMetabolites inactive at GIPR/GLP-1R

Receptor Pharmacology#

Tirzepatide displays an imbalanced agonist profile at its two target receptors:

  • GIP receptor (GIPR): Tirzepatide binds to and activates GIPR with high affinity, approximately equivalent to or exceeding native GIP. Studies report an EC50 at GIPR that is approximately 5-fold more potent than native GIP in cAMP generation assays.
  • GLP-1 receptor (GLP-1R): Tirzepatide activates GLP-1R with lower relative potency compared to native GLP-1, approximately 0.01- to 0.02-fold in in vitro signaling assays. However, this lower in vitro potency is compensated by the high circulating concentrations achieved with therapeutic doses, resulting in clinically meaningful GLP-1R activation.
  • Biased agonism: Research suggests that tirzepatide may exhibit biased agonism at GLP-1R, preferentially activating G protein-mediated signaling (cAMP) over beta-arrestin recruitment. This biased signaling profile may contribute to its favorable tolerability relative to its weight and glycemic effects, as beta-arrestin-mediated GLP-1R internalization has been associated with desensitization and gastrointestinal side effects.

Structural Comparison with Native Incretins#

The design of tirzepatide involved significant molecular engineering relative to the native incretin hormones:

  • vs. Native GIP(1-42): Tirzepatide retains the core N-terminal sequence of GIP but incorporates 5 amino acid substitutions that introduce GLP-1R cross-reactivity. The Aib2 substitution and C20 fatty diacid are not present in native GIP.
  • vs. Native GLP-1(7-36) amide: Tirzepatide shares limited sequence identity with GLP-1 (approximately 50%) but incorporates strategically placed residues that enable GLP-1R engagement. The overall backbone length (39 residues vs. 30 residues for GLP-1) and GIP-derived framework distinguish it from pure GLP-1 analogs.

This dual-agonist design reflects the hypothesis that concurrent activation of both GIP and GLP-1 signaling pathways produces complementary and potentially synergistic metabolic effects that exceed what either pathway achieves independently, a concept validated by the clinical outcomes in the SURPASS and SURMOUNT trial programs.

Frequently Asked Questions About Tirzepatide

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer