Tirzepatide: Molecular Structure
Chemical properties, amino acid sequence, and structural analysis
📌TL;DR
- •Molecular formula: C225H348N48O68
- •Molecular weight: 4813.45 Da
- •Half-life: Approximately 5 days
Amino Acid Sequence
69 amino acids
Formula
C225H348N48O68
Molecular Weight
4813.45 Da
Half-Life
Approximately 5 days


Molecular Structure and Properties#
Tirzepatide (LY3298176) is a 39-amino-acid synthetic peptide engineered as a first-in-class dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist. It was developed by Eli Lilly and Company and has a molecular weight of approximately 4,813.45 Da, with the molecular formula C225H348N48O68 and CAS number 2023788-19-2. Tirzepatide represents a novel approach to metabolic therapeutics, combining activity at two incretin receptors within a single molecule.
Amino Acid Sequence#
The primary structure of tirzepatide is a 39-amino-acid linear peptide based on the native human GIP(1-42) sequence, with specific modifications to confer dual receptor activity, enzymatic resistance, and prolonged duration of action. The sequence is:
Y-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
with a C20 fatty diacid moiety conjugated at the lysine residue at position 20 via a gamma-glutamic acid-based linker.
Key residues and their functional significance include:
- Position 1 (Tyrosine): Retained from native GIP; critical for receptor engagement at both GIPR and GLP-1R.
- Position 2 (Alpha-aminoisobutyric acid, Aib): This non-natural amino acid replaces the native alanine at position 2, conferring resistance to dipeptidyl peptidase-4 (DPP-4) cleavage. DPP-4 is a serine protease that rapidly inactivates native GIP and GLP-1 by removing the N-terminal dipeptide, resulting in half-lives of only minutes for the endogenous hormones. The Aib substitution sterically hinders DPP-4 from recognizing and cleaving the N-terminus.
- Positions 12 and 13: Modified from native GIP to introduce GLP-1 receptor cross-reactivity. The substitutions at these positions, along with other sequence changes, allow tirzepatide to engage GLP-1R with therapeutically meaningful potency despite the GIP-based backbone.
- Position 14 (Glutamic acid): Contributes to GLP-1R binding affinity.
- Position 20 (Lysine): Serves as the conjugation site for the C20 fatty diacid moiety, which is attached through a gamma-glutamic acid (gamma-Glu) spacer and a mini-polyethylene glycol linker. This lipidation is essential for albumin binding and the resulting prolonged half-life.
- C-terminal amidation (-NH2): The peptide chain terminates with a C-terminal amide group rather than a free carboxylic acid, which enhances metabolic stability and is a common modification in therapeutic peptides.
The overall design philosophy uses the GIP backbone to maintain high-affinity GIPR activation while incorporating specific amino acid substitutions that introduce GLP-1R agonism. In vitro studies demonstrate that tirzepatide activates GIPR with approximately 5-fold greater potency than native GIP, while at GLP-1R it shows approximately 0.02-fold the potency of native GLP-1, though this reduced potency is compensated by the high plasma concentrations achieved clinically.
| Property | Value | Notes |
|---|---|---|
| Sequence length | 39 amino acids | Linear peptide |
| Molecular weight | ~4,813.45 Da | Including C20 fatty diacid |
| Molecular formula | C225H348N48O68 | Complete molecule |
| CAS number | 2023788-19-2 | Registry identifier |
| Non-natural residue | Aib at position 2 | DPP-4 resistance |
| Lipid modification | C20 fatty diacid at Lys20 | Via gamma-Glu linker |
| C-terminus | Amidated (-NH2) | Enhanced stability |
| Backbone origin | GIP(1-42) sequence | Modified for dual activity |
Lipid Modification and Albumin Binding#
The C20 fatty diacid (eicosanedioic acid) conjugated at Lys20 is a defining structural feature of tirzepatide. This modification serves multiple pharmacological purposes:
-
Albumin binding: The fatty diacid moiety binds non-covalently to serum albumin (binding >99%), creating a circulating depot that shields the peptide from renal filtration and proteolytic degradation. This extends the half-life from minutes (unmodified peptide) to approximately 5 days, enabling once-weekly subcutaneous dosing.
-
Linker architecture: The connection between the peptide backbone at Lys20 and the fatty diacid employs a gamma-glutamic acid spacer coupled with a hydrophilic mini-PEG element. This linker design balances the lipophilicity needed for albumin binding with sufficient aqueous solubility for formulation and subcutaneous depot absorption.
-
Pharmacokinetic optimization: The albumin-bound tirzepatide circulates as a slow-release reservoir. Free peptide dissociates from albumin to engage target receptors, while the albumin-bound fraction maintains steady-state plasma concentrations with low peak-to-trough variability across the weekly dosing interval.
This lipidation strategy is conceptually related to the C18 fatty diacid used in semaglutide, though tirzepatide employs a longer C20 chain and a different linker architecture, contributing to its distinct pharmacokinetic profile.
Physicochemical Properties#
Tirzepatide is formulated as a clear, colorless to slightly yellow solution for subcutaneous injection. Key physicochemical characteristics include:
- Solubility: Formulated in an aqueous phosphate buffer at pH 4.5, with sodium chloride as tonicity agent and suitable preservatives.
- Stability: The formulation is stable under refrigerated conditions (2-8 degrees C) and for limited periods at controlled room temperature (up to 30 degrees C for 21 days).
- Isoelectric point: The theoretical pI is in the range of approximately 4.5-5.0, reflecting the balance of acidic and basic residues in the sequence. The multiple glutamic acid and aspartic acid residues contribute to a net negative charge at physiological pH.
Pharmacokinetics#
Tirzepatide exhibits predictable, dose-proportional pharmacokinetics across the clinically used dose range (2.5 mg to 15 mg weekly subcutaneous injection).
Absorption: After subcutaneous injection, tirzepatide is absorbed relatively slowly due to its lipidated nature and albumin-binding properties. The time to maximum plasma concentration (Tmax) ranges from approximately 8 to 72 hours post-injection, with a median of approximately 24 hours. Absolute bioavailability after subcutaneous administration is approximately 80%.
Distribution: The apparent volume of distribution at steady state is approximately 10.3 liters, which is consistent with distribution primarily in the vascular compartment due to extensive albumin binding (>99%). The high degree of protein binding limits extravascular distribution and contributes to the prolonged half-life.
Metabolism: Tirzepatide is metabolized through proteolytic cleavage of the peptide backbone, beta-oxidation of the C20 fatty diacid moiety, and amide hydrolysis. Importantly, tirzepatide does not undergo clinically meaningful metabolism by cytochrome P450 (CYP) enzymes, and therefore CYP-mediated drug-drug interactions are not expected. The metabolites are not pharmacologically active at GIPR or GLP-1R.
Elimination: The elimination half-life is approximately 5 days (approximately 117 hours), supporting once-weekly dosing. Clearance is approximately 0.061 L/hr. Tirzepatide is primarily eliminated through metabolic degradation; no single organ is the predominant route of elimination. Steady-state concentrations are typically achieved after 4 weeks (4 doses) of once-weekly administration.
| PK Parameter | Value | Notes |
|---|---|---|
| Tmax | 8-72 hours (median ~24 h) | Subcutaneous injection |
| Bioavailability | ~80% | Subcutaneous administration |
| Vd (steady state) | ~10.3 L | Primarily vascular compartment |
| Protein binding | >99% | Albumin binding |
| Half-life | ~5 days (117 h) | Supports weekly dosing |
| Clearance | ~0.061 L/hr | Metabolic elimination |
| Time to steady state | ~4 weeks | With weekly dosing |
| CYP metabolism | Not significant | CYP-independent |
| Active metabolites | None identified | Metabolites inactive at GIPR/GLP-1R |
Receptor Pharmacology#
Tirzepatide displays an imbalanced agonist profile at its two target receptors:
- GIP receptor (GIPR): Tirzepatide binds to and activates GIPR with high affinity, approximately equivalent to or exceeding native GIP. Studies report an EC50 at GIPR that is approximately 5-fold more potent than native GIP in cAMP generation assays.
- GLP-1 receptor (GLP-1R): Tirzepatide activates GLP-1R with lower relative potency compared to native GLP-1, approximately 0.01- to 0.02-fold in in vitro signaling assays. However, this lower in vitro potency is compensated by the high circulating concentrations achieved with therapeutic doses, resulting in clinically meaningful GLP-1R activation.
- Biased agonism: Research suggests that tirzepatide may exhibit biased agonism at GLP-1R, preferentially activating G protein-mediated signaling (cAMP) over beta-arrestin recruitment. This biased signaling profile may contribute to its favorable tolerability relative to its weight and glycemic effects, as beta-arrestin-mediated GLP-1R internalization has been associated with desensitization and gastrointestinal side effects.
Structural Comparison with Native Incretins#
The design of tirzepatide involved significant molecular engineering relative to the native incretin hormones:
- vs. Native GIP(1-42): Tirzepatide retains the core N-terminal sequence of GIP but incorporates 5 amino acid substitutions that introduce GLP-1R cross-reactivity. The Aib2 substitution and C20 fatty diacid are not present in native GIP.
- vs. Native GLP-1(7-36) amide: Tirzepatide shares limited sequence identity with GLP-1 (approximately 50%) but incorporates strategically placed residues that enable GLP-1R engagement. The overall backbone length (39 residues vs. 30 residues for GLP-1) and GIP-derived framework distinguish it from pure GLP-1 analogs.
This dual-agonist design reflects the hypothesis that concurrent activation of both GIP and GLP-1 signaling pathways produces complementary and potentially synergistic metabolic effects that exceed what either pathway achieves independently, a concept validated by the clinical outcomes in the SURPASS and SURMOUNT trial programs.
Related Reading#
Frequently Asked Questions About Tirzepatide
What type of peptide is Tirzepatide?
Tirzepatide is a first-in-class dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist developed by Eli Lilly. FDA-approved as Mounjaro (2022) for type 2 diabetes and Zepbound (2023) for chronic weight management, tirzepatide is a 39-amino-acid synthetic peptide with a C20 fatty diacid moiety that enables once-weekly dosing. In the SURMOUNT-1 trial, participants achieved up to 22.5% mean body weight reduction at the highest dose.
What is the half-life of Tirzepatide?
The reported half-life of Tirzepatide is Approximately 5 days. Half-life can vary depending on the route of administration, formulation, and individual factors. This information is based on available preclinical or pharmacokinetic data.
What is the amino acid sequence of Tirzepatide?
The amino acid sequence of Tirzepatide is Y(Aib)EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C20 fatty diacid at Lys20. 39-amino-acid linear peptide with C20 fatty diacid modification for albumin binding. This sequence determines its biological activity and binding properties.
How stable is Tirzepatide in storage?
Tirzepatide is typically supplied as a lyophilized powder for maximum stability. 39-amino-acid linear peptide with C20 fatty diacid modification for albumin binding. When reconstituted, it should be stored refrigerated at 2-8 degrees C and protected from light. Lyophilized powder should be stored at -20 degrees C.
Explore Further
Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer