Skip to main content

Teriparatide

Also known as: Forteo, rhPTH(1-34)

Research compiled by Peptide Protocol Wiki
๐Ÿ“…Updated February 12, 2026
Citations verified: February 12, 2026
Citations Verified February 12, 2026
New to musculoskeletal peptides?Browse all musculoskeletal peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขFirst FDA-approved osteoanabolic agent with 20+ years of clinical experience
  • โ€ข65% reduction in vertebral fractures and 53% in nonvertebral fractures
  • โ€ขSuperior to alendronate in glucocorticoid-induced osteoporosis
  • โ€ขOsteosarcoma boxed warning removed in 2020; no treatment duration limit
  • โ€ขBiosimilar availability improving access and affordability

Community-Reported Side EffectsAnecdotal?

Protocol Quick-Reference

Osteoporosis in postmenopausal women, men, and GIO patients at high fracture risk

Dosing

Amount

20 mcg fixed dose

Frequency

Once daily

Duration

Determined by clinical judgment (no limit)

Administration

Route

SC

Schedule

Once daily

Timing

Same time each day; no food restrictions

โœ“ Rotate injection sites

Cycle

Duration

Determined by clinical judgment

Repeatable

Yes

Preparation & Storage

โœ“ Ready-to-use โ€” no reconstitution required

Storage: Refrigerate at 2-8 degrees C at all times. Do not freeze. Pen usable for 28 days after first injection.

โš—๏ธ Suggested Bloodwork (5 tests)

Serum calcium

When: Baseline

Why: Rule out pre-existing hypercalcemia

25-hydroxyvitamin D

When: Baseline

Why: Ensure adequate vitamin D before treatment

DEXA bone density scan

When: Baseline

Why: Establish baseline BMD at spine and hip

Serum calcium

When: Periodic

Why: Monitor for hypercalcemia

DEXA bone density scan

When: 12-24 months

Why: Assess BMD response

๐Ÿ’ก Key Considerations
  • โ†’Follow with antiresorptive therapy after discontinuation to consolidate BMD gains
  • โ†’Ensure adequate calcium and vitamin D supplementation
  • โ†’Contraindicated in Paget disease, unexplained elevated ALP, open epiphyses, prior skeletal radiation, and pre-existing hypercalcemia

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates โ€” free.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for Teriparatide
How Teriparatide works at the cellular level
Key benefits and uses of Teriparatide
Overview of Teriparatide benefits and applications
Scientific Details
Molecular Formula
C181H291N55O51S2
Molecular Weight
4117.8 Da
CAS Number
52232-67-4
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

What is Teriparatide?#

Teriparatide is a recombinant form of human parathyroid hormone consisting of the first 34 N-terminal amino acids (PTH(1-34)), which represent the biologically active region of the full 84-amino-acid PTH molecule. Developed by Eli Lilly and marketed as Forteo, teriparatide was FDA-approved in November 2002 as the first osteoanabolic (bone-forming) agent for the treatment of osteoporosis.

Teriparatide is manufactured using recombinant DNA technology in a strain of Escherichia coli. It has an identical amino acid sequence to the N-terminal 34 residues of endogenous human PTH, ensuring native receptor binding and signaling properties.

Teriparatide is indicated for:

  • Postmenopausal osteoporosis: Women at high risk for fracture, defined as history of osteoporotic fracture, multiple risk factors, or failure/intolerance of other osteoporosis therapy
  • Male osteoporosis: Men with primary or hypogonadal osteoporosis at high risk for fracture
  • Glucocorticoid-induced osteoporosis (GIO): Men and women with osteoporosis associated with sustained systemic glucocorticoid therapy at high risk for fracture

Mechanism of Action#

Teriparatide acts by binding to the parathyroid hormone 1 receptor (PTH1R), a G protein-coupled receptor expressed on osteoblasts, osteocytes, and renal tubular cells. The therapeutic effect depends critically on the pattern of exposure:

Intermittent vs. Continuous Exposure#

  • Intermittent (pulsatile) exposure: Daily subcutaneous injection produces a brief peak in PTH(1-34) levels lasting 4-6 hours, followed by clearance. This pulsatile pattern preferentially stimulates osteoblast proliferation, differentiation, and survival while having a lesser effect on osteoclast activation. The net result is increased bone formation exceeding resorption -- the anabolic window.

  • Continuous exposure: Sustained PTH elevation (as in primary hyperparathyroidism) activates both osteoblasts and osteoclasts, with the catabolic (resorptive) effects predominating, leading to net bone loss particularly at cortical sites. This is why continuous PTH excess causes osteoporosis rather than preventing it.

Key Signaling Pathways#

Upon PTH1R activation, teriparatide stimulates:

  • cAMP/protein kinase A (PKA) pathway: primary signaling cascade driving osteoblast differentiation
  • Wnt/beta-catenin pathway activation: promotes osteoblast proliferation and inhibits osteoblast apoptosis
  • Downregulation of sclerostin: reduces osteocyte-derived inhibition of bone formation
  • RANKL modulation: complex effects on osteoclast recruitment depending on exposure pattern

Research Overview#

Teriparatide has the most extensive long-term evidence base of any osteoanabolic agent, spanning over 20 years of clinical experience. The pivotal Fracture Prevention Trial demonstrated 65% reduction in vertebral fractures and 53% reduction in nonvertebral fractures. Teriparatide was subsequently shown to be superior to alendronate for glucocorticoid-induced osteoporosis, making it the only osteoanabolic with formal GIO approval.

The 2020 removal of the osteosarcoma boxed warning, based on 18 years of post-marketing surveillance data, was a landmark regulatory decision that eliminated the 2-year treatment duration limit.

Important Considerations#

  • Prescription medication requiring medical supervision
  • No longer limited to 2 years of cumulative use (boxed warning removed 2020)
  • Most common adverse effects are hypercalcemia, dizziness, leg cramps, and nausea
  • Contraindicated in patients with Paget disease, unexplained alkaline phosphatase elevation, open epiphyses, prior skeletal radiation, or pre-existing hypercalcemia
  • Should be followed by antiresorptive therapy to maintain BMD gains
  • Biosimilar versions available, improving cost accessibility

Key Research Findings#

Effect of Parathyroid Hormone (1-34) on Fractures and Bone Mineral Density in Postmenopausal Women with Osteoporosis, published in New England Journal of Medicine (Neer RM et al., 2001; PMID: 11346808):

  • The study showed vertebral fracture risk reduction of 65% with 20 mcg
  • The study showed nonvertebral fracture risk reduction of 53% with 20 mcg
  • The study showed lumbar spine BMD increase of 9% at 21 months with 20 mcg
  • The study showed femoral neck BMD increase of 3% at 21 months with 20 mcg

Teriparatide or Alendronate in Glucocorticoid-Induced Osteoporosis, published in New England Journal of Medicine (Saag KG et al., 2007; PMID: 18003959):

  • The study showed lumbar spine BMD of 7.2% teriparatide vs +3.4% alendronate
  • The study showed vertebral fractures of 0.6% teriparatide vs 6.1% alendronate

Stay current on Teriparatide research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 80+ community reports

View community protocols

Frequently Asked Questions About Teriparatide

What is teriparatide?

Teriparatide (Forteo) is a recombinant form of the first 34 amino acids of human parathyroid hormone. It is the biologically active fragment of PTH and acts as an osteoanabolic agent that stimulates new bone formation when administered as daily subcutaneous injections.

How does teriparatide differ from abaloparatide?

Both activate the PTH1 receptor to build new bone. Teriparatide is identical to native PTH(1-34) and binds both RG and R0 receptor conformations, while abaloparatide is a PTHrP analog with RG-selective binding. Teriparatide has higher hypercalcemia rates but broader approved indications including glucocorticoid-induced osteoporosis.

Is there still a 2-year treatment limit for teriparatide?

No. In 2020, the FDA removed the osteosarcoma boxed warning and the 2-year cumulative treatment duration limit from the teriparatide label, based on 18 years of post-marketing surveillance showing no increased osteosarcoma risk in humans.

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting