Skip to main content
🧬Peptide Protocol Wiki

Albiglutide (Tanzeum): Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Research compiled by Peptide Protocol Wiki
📅Updated February 12, 2026
Citations Verified

📌TL;DR

  • Molecular formula: Recombinant fusion protein (not expressed as simple formula)
  • Molecular weight: 72900 Da
  • Half-life: ~5 days (range 4-7 days), enabling once-weekly subcutaneous injection

Amino Acid Sequence

Two tandem copies of human GLP-1(7-36 amide) with Ala8Gly substitution, genetically fused to the N-terminus of recombinant human serum albumin. Total: 645 amino acids. GLP-1 portion: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGR (x2, with Gly8 substitution), fused to 585-aa human serum albumin.

280 amino acids

Formula

Recombinant fusion protein (not expressed as simple formula)

Molecular Weight

72900 Da

Half-Life

~5 days (range 4-7 days), enabling once-weekly subcutaneous injection

3D molecular structure of Albiglutide (Tanzeum)
Three-dimensional representation of Albiglutide (Tanzeum)
Amino acid sequence diagram for Albiglutide (Tanzeum)
Color-coded amino acid sequence of Albiglutide (Tanzeum)

Molecular Overview#

Albiglutide (Tanzeum/Eperzan) is a 72.9 kDa recombinant fusion protein that combined two copies of modified GLP-1 with human serum albumin to achieve once-weekly dosing for type 2 diabetes.

Structure and Design#

The molecular design of albiglutide involved three key engineering strategies:

  1. Tandem GLP-1 duplication: Two copies of GLP-1(7-36 amide) were arranged in tandem to increase receptor engagement
  2. DPP-4 resistance: The Ala8Gly substitution in each GLP-1 copy prevented enzymatic degradation by DPP-4, the primary enzyme that inactivates native GLP-1 (half-life ~2 minutes)
  3. Albumin fusion: Genetic fusion to human serum albumin (585 amino acids) extended the half-life to approximately 5 days through FcRn-mediated recycling and reduced renal filtration

Physical and Chemical Properties#

PropertyValue
Molecular weight~72.9 kDa
Total amino acids645
CAS number782500-75-8
Expression systemSaccharomyces cerevisiae
GlycosylationNone
Disulfide bonds17 (from albumin domain)
FormulationLyophilized powder for reconstitution
StorageRoom temperature stable after reconstitution

Pharmacokinetics#

Albiglutide had a terminal half-life of approximately 5 days (range 4-7 days), supporting once-weekly subcutaneous dosing. Peak plasma concentrations occurred 3-5 days after injection. The albumin fusion approach provided a more gradual pharmacokinetic profile compared to acylation-based GLP-1 agonists, which may have contributed to the lower GI side effect rates but also to reduced peak receptor activation and lower efficacy.

Comparison with Other GLP-1 Half-Life Extension Strategies#

StrategyExampleHalf-lifeMolecular Weight
Albumin fusionAlbiglutide~5 days72.9 kDa
Fatty acid acylation (C18)Semaglutide~7 days4.1 kDa
Fatty acid acylation (C16)Liraglutide~13 hours3.7 kDa
Fc fusionDulaglutide~5 days59.7 kDa

The albumin fusion strategy produced one of the largest GLP-1 agonist molecules. While effective for half-life extension, the large molecular size may have reduced receptor binding affinity compared to the native peptide, potentially explaining albiglutide's lower efficacy relative to smaller acylated GLP-1 agonists.

Molecular Context#

Albiglutide (Tanzeum) belongs to the Metabolic category of research peptides. The molecular properties of Albiglutide (Tanzeum) determine its pharmacological behavior, including receptor binding, distribution, metabolism, and elimination. Understanding these properties is fundamental to interpreting clinical data and designing research protocols.

Structural Overview#

Albiglutide (Tanzeum) is characterized as: Albiglutide is a 72.9 kDa recombinant fusion protein produced in Saccharomyces cerevisiae. It consists of two tandem copies of modified human GLP-1(7-36 amide) genetically fused to the N-terminus of human serum albumin (585 amino acids). The GLP-1 sequences contain an Ala8Gly substitution to confer resistance to dipeptidyl peptidase-4 (DPP-4) cleavage. The albumin carrier provides half-life extension through FcRn-mediated recycling and reduced renal clearance. The protein contains 17 disulfide bonds from the albumin domain and is not glycosylated..

Amino Acid Sequence Details#

The amino acid sequence of Albiglutide (Tanzeum) is: Two tandem copies of human GLP-1(7-36 amide) with Ala8Gly substitution, genetically fused to the N-terminus of recombinant human serum albumin. Total: 645 amino acids. GLP-1 portion: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGR (x2, with Gly8 substitution), fused to 585-aa human serum albumin.. This sequence determines the peptide's three-dimensional structure, receptor binding properties, and biological activity.

Pharmacokinetic Profile#

Half-Life: ~5 days (range 4-7 days), enabling once-weekly subcutaneous injection

The half-life of a peptide influences dosing frequency, duration of effect, and the clinical utility of the compound. Researchers should consider the half-life when designing experimental protocols.

Frequently Asked Questions About Albiglutide (Tanzeum)

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer