Pramlintide (Symlin): Molecular Structure
Chemical properties, amino acid sequence, and structural analysis
📌TL;DR
- •Molecular formula: C171H267N51O53S2
- •Molecular weight: 3949.4 Da
- •Half-life: ~48 minutes following subcutaneous injection
Amino Acid Sequence
269 amino acids
Formula
C171H267N51O53S2
Molecular Weight
3949.4 Da
Half-Life
~48 minutes following subcutaneous injection


Molecular Overview#
Pramlintide (Symlin) is a 37-amino acid synthetic peptide that replicates the physiological effects of human amylin while incorporating critical structural modifications to prevent the amyloid aggregation that makes native amylin unsuitable as a drug.
Structural Design#
The key engineering challenge in developing pramlintide was preventing amyloid aggregation while preserving receptor binding and biological activity:
- Proline substitutions: Three amino acid replacements (Ala25Pro, Ser28Pro, Ser29Pro) were modeled after rat amylin, which naturally does not form amyloid fibrils. Proline residues break beta-sheet structure, preventing the intermolecular hydrogen bonding that drives aggregation
- Disulfide bridge: The Cys2-Cys7 disulfide bond constrains the N-terminal loop, which is essential for receptor binding to the calcitonin receptor/RAMP complex
- C-terminal amidation: The amidated C-terminus is required for full biological activity, consistent with the native amylin structure
Physical and Chemical Properties#
| Property | Value |
|---|---|
| Molecular weight | 3,949.4 Da |
| Molecular formula | C171H267N51O53S2 |
| CAS number | 151126-32-8 |
| Amino acids | 37 |
| Disulfide bonds | 1 (Cys2-Cys7) |
| Key modifications | Pro25, Pro28, Pro29 (vs human amylin) |
| C-terminal | Amidated |
| Formulation | Solution for injection (1,000 mcg/mL) |
| pH | ~4.0 (acidic, incompatible with insulin) |
Pharmacokinetics#
Pramlintide has a very short half-life of approximately 48 minutes following subcutaneous injection, necessitating administration before each major meal. Peak plasma concentrations are reached approximately 20 minutes after injection. The rapid clearance is consistent with the physiological pattern of amylin secretion, which occurs in pulsatile fashion with meals.
| PK Parameter | Value |
|---|---|
| Half-life | ~48 minutes |
| Tmax | ~20 minutes |
| Bioavailability | ~30-40% (SC) |
| Clearance | Primarily renal |
| Volume of distribution | ~0.2 L/kg |
Comparison with Native Amylin and Cagrilintide#
| Feature | Pramlintide | Human Amylin | Cagrilintide |
|---|---|---|---|
| Amino acids | 37 | 37 | 37 (modified) |
| Half-life | ~48 minutes | ~13 minutes | ~7 days |
| Aggregation | Non-aggregating | Amyloid-forming | Non-aggregating |
| Dosing | Before each meal | N/A (endogenous) | Once weekly |
| Key modification | Pro25,28,29 | Native | Acylation + AA changes |
| Receptor | CT/RAMP | CT/RAMP | CT/RAMP |
The very short half-life of pramlintide, requiring 3 daily injections, represents a significant limitation compared to the emerging long-acting amylin analogs like cagrilintide, which achieve weekly dosing through fatty acid acylation.
Molecular Context#
Pramlintide (Symlin) belongs to the Metabolic category of research peptides. The molecular properties of Pramlintide (Symlin) determine its pharmacological behavior, including receptor binding, distribution, metabolism, and elimination. Understanding these properties is fundamental to interpreting clinical data and designing research protocols.
Structural Overview#
Pramlintide (Symlin) is characterized as: Pramlintide is a 37-amino acid synthetic analog of human amylin with a molecular weight of 3,949.4 Da. It differs from native human amylin by three proline substitutions at positions 25, 28, and 29. These prolines were incorporated based on the rat amylin sequence, which naturally resists aggregation. The molecule contains a disulfide bridge between Cys2 and Cys7 and is C-terminal amidated. The proline substitutions disrupt the beta-sheet secondary structure that drives amyloid fibril formation in native amylin, making pramlintide soluble and suitable for pharmaceutical use while retaining full receptor activity..
Amino Acid Sequence Details#
The amino acid sequence of Pramlintide (Symlin) is: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2. 37 amino acids with a disulfide bridge between Cys2 and Cys7. Three proline substitutions at positions 25, 28, and 29 (Ala25Pro, Ser28Pro, Ser29Pro) versus human amylin to prevent amyloid fibril formation. C-terminal amidated.. This sequence determines the peptide's three-dimensional structure, receptor binding properties, and biological activity.
Pharmacokinetic Profile#
Half-Life: ~48 minutes following subcutaneous injection
The half-life of a peptide influences dosing frequency, duration of effect, and the clinical utility of the compound. Researchers should consider the half-life when designing experimental protocols.
Related Reading#
Frequently Asked Questions About Pramlintide (Symlin)
Explore Further
Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer