Skip to main content
🧬Peptide Protocol Wiki

PNC-27: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Research compiled by Peptide Protocol Wiki
📅Updated February 8, 2026
Citations Verified

📌TL;DR

  • Molecular formula: C188H293N53O44S
  • Molecular weight: 4031.7 Da
  • Half-life: Not established (preclinical only)

Amino Acid Sequence

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

32 amino acids

Formula

C188H293N53O44S

Molecular Weight

4031.7 Da

Half-Life

Not established (preclinical only)

3D molecular structure of PNC-27
Three-dimensional representation of PNC-27
Amino acid sequence diagram for PNC-27
Color-coded amino acid sequence of PNC-27

Molecular Structure and Properties#

PNC-27 is a rationally designed chimeric peptide that combines two distinct functional domains into a single 32-amino acid molecule. Understanding its molecular architecture is essential for interpreting its selective anticancer mechanism and for designing potential improvements or analogs.

Primary Structure#

Complete Amino Acid Sequence#

The full sequence of PNC-27 in single-letter code:

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

In three-letter code: Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly

Domain Organization#

PNC-27 consists of two functionally distinct domains joined in a linear fusion:

DomainResiduesSequenceOriginFunction
HDM-2 binding1-15PPLSQETFSDLWKLLp53 (residues 12-26)Cancer cell targeting via HDM-2
MRP (membrane residency peptide)16-32KKWKMRRNQFWVKVQRGAntennapedia helix 3Membrane penetration and pore formation

The N-terminal domain corresponds to the minimal binding epitope of human p53 that interacts with the hydrophobic cleft of HDM-2. This sequence was identified through X-ray crystallography of the p53-MDM2 complex, which revealed that three key hydrophobic residues (Phe19, Trp23, and Leu26 of p53, corresponding to Phe8, Trp12, and Leu15 in PNC-27) make critical contacts within the HDM-2 binding pocket.

The C-terminal domain is derived from the third helix of the Drosophila antennapedia homeodomain protein. This sequence, sometimes called penetratin, is one of the most extensively characterized cell-penetrating peptides and has the ability to translocate across lipid bilayers and disrupt membrane integrity at sufficient concentrations.

Physicochemical Properties#

PropertyValue
Amino acids32
Molecular formulaC188H293N53O44S
Molecular weight4031.7 Da
CAS Number1159861-00-3
Isoelectric point~11.5 (highly basic)
Net charge at pH 7.4+8 (8 basic residues: 5 Lys, 3 Arg)
HydrophobicityAmphipathic (hydrophobic N-terminus, cationic C-terminus)
Extinction coefficient (280 nm)~21,860 M-1cm-1 (estimated)
Sulfur-containing residues1 Met (position 20)
Aromatic residues3 Trp, 2 Phe

Amino Acid Composition Analysis#

The amino acid composition of PNC-27 reveals a distinctive character that reflects its dual function:

Charged residues (11/32, 34%):

  • Basic: Lys x5, Arg x3 = 8 positive charges
  • Acidic: Glu x1, Asp x1 = 2 negative charges
  • Net charge: +6 at physiological pH

Hydrophobic residues (10/32, 31%):

  • Leu x3, Pro x2, Phe x2, Trp x3, Val x2, Met x1

Polar uncharged residues (9/32, 28%):

  • Ser x2, Thr x1, Asn x1, Gln x2, Gly x1

The high proportion of basic and hydrophobic residues, combined with the amphipathic arrangement (hydrophobic residues concentrated in the N-terminal HDM-2-binding domain and cationic residues concentrated in the C-terminal MRP domain), is characteristic of membrane-active peptides.

Secondary and Tertiary Structure#

Conformational Properties#

PNC-27 does not adopt a single stable three-dimensional structure in aqueous solution. Like many bioactive peptides, it exists as a conformational ensemble in the unbound state. However, upon binding to its target HDM-2 protein, PNC-27 undergoes a significant conformational change.

HDM-2-Bound Conformation#

Conformational energy calculations and molecular modeling studies published in PNAS (2010) revealed that when PNC-27 binds to the N-terminal domain of HDM-2, it adopts an amphipathic helix-loop-helix conformation. In this bound state:

  • The HDM-2-binding domain (residues 1-15) folds into an alpha-helix that inserts into the hydrophobic cleft of HDM-2, mimicking the native p53-HDM-2 interaction
  • The three critical hydrophobic residues (Phe8, Trp12, Leu15) are positioned to make the same contacts with HDM-2 as the corresponding p53 residues
  • A short loop connects the HDM-2-binding helix to the MRP domain
  • The MRP domain adopts a second helical conformation that points away from the HDM-2 binding interface and toward the cell membrane

This structural arrangement positions the membrane-active MRP domain for insertion into the lipid bilayer while the HDM-2-binding domain anchors the peptide to its protein target on the cell surface. The 1:1 stoichiometry of the PNC-27:HDM-2 complex means that each HDM-2 molecule on the membrane surface serves as an anchor point for one PNC-27 molecule.

Comparison with Native p53-HDM-2 Interaction#

The X-ray crystal structure of the p53-MDM2 complex (PDB: 1YCR) shows that the p53 transactivation domain binds MDM2 as an amphipathic alpha-helix. PNC-27's HDM-2-binding domain replicates this interaction:

Residue in p53Residue in PNC-27Role
Phe19Phe8Hydrophobic contact in MDM2 pocket
Trp23Trp12Deep insertion into MDM2 cleft (critical)
Leu26Leu15Hydrophobic contact

These three residues form the "hot spot" of the p53-MDM2 interaction. Mutation of any of these residues dramatically reduces binding affinity, and they are conserved in PNC-27 to maintain HDM-2 binding.

Membrane Pore Architecture#

Pore Formation Model#

Based on electron microscopy studies using gold-labeled antibodies, the transmembrane pores formed by PNC-27 have been characterized. The current model proposes:

  1. Multiple PNC-27:HDM-2 complexes cluster in the membrane
  2. The MRP domains insert into the lipid bilayer, creating a barrel-like pore structure
  3. Pores consist of alternating PNC-27 and HDM-2 molecules in ring-shaped arrangements
  4. Both 6 nm and 15 nm gold particles (conjugated to anti-PNC-27 and anti-HDM-2 antibodies, respectively) are found in approximately 1:1 ratios within pore structures
  5. The resulting pores are large enough (estimated 6-15 nm diameter) to allow passage of proteins and organelle contents

This pore architecture is consistent with a "barrel-stave" model of membrane disruption, where amphipathic peptides insert perpendicularly into the lipid bilayer with their hydrophilic faces oriented toward the pore interior and their hydrophobic faces interacting with lipid acyl chains.

Stability Considerations#

Proteolytic Sensitivity#

As a linear peptide without disulfide bonds, post-translational modifications, or chemical stabilization, PNC-27 is expected to be susceptible to proteolytic degradation by serum proteases. The peptide contains multiple potential cleavage sites for common serum proteases:

  • Trypsin-like proteases may cleave after Lys and Arg residues (8 potential sites)
  • Chymotrypsin-like proteases may cleave after Phe, Trp, and Leu residues (8 potential sites)

However, a key finding is that PNC-27 induces tumor cell lysis as the intact peptide. Studies have shown that it is the full-length 32-amino acid peptide, not degradation fragments, that is responsible for anticancer activity. This was confirmed by testing peptide fragments and demonstrating that only the intact chimeric peptide retains full activity.

Storage Stability#

PNC-27 is commercially available as a lyophilized powder, which provides the best storage stability. Typical storage recommendations include:

  • Lyophilized powder: -20 degrees Celsius, protected from light and moisture
  • Reconstituted solution: 2-8 degrees Celsius, use within days to weeks
  • Avoid repeated freeze-thaw cycles

Analytical Methods#

Methods for characterizing PNC-27 include:

  • Mass spectrometry (MALDI-TOF, ESI-MS): Confirms molecular weight of 4031.7 Da
  • HPLC: Assesses peptide purity (typically >95% for research grade)
  • Circular dichroism (CD) spectroscopy: Characterizes secondary structure in solution and upon binding to HDM-2
  • Fluorescence spectroscopy: The three tryptophan residues provide intrinsic fluorescence probes for monitoring conformational changes and binding events
  • Immunogold electron microscopy: Visualizes pore structures in cell membranes

Evidence Gaps#

  • No experimentally determined three-dimensional structure (crystal or NMR) of PNC-27 alone or in complex with HDM-2
  • The detailed stoichiometry and architecture of membrane pores require higher-resolution structural data
  • Whether the MRP domain inserts as a transmembrane helix or adopts an alternative membrane topology has not been definitively established
  • The contribution of each domain to overall peptide stability in biological fluids has not been quantified
  • No pharmacokinetic data (half-life, volume of distribution, clearance) has been published for PNC-27 in any species

Frequently Asked Questions About PNC-27

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer