Skip to main content
๐ŸงฌPeptide Protocol Wiki

PNC-27

Also known as: p53-derived Peptide, PNC-27, HDM2-binding Peptide, PNC27 Anticancer Peptide

Research compiled by Peptide Protocol Wiki
๐Ÿ“…Updated February 8, 2026
Citations Verified
New to anti-aging peptides?Browse all anti-aging peptides โ†’

๐Ÿ“ŒTL;DR

  • โ€ขSelective cytotoxicity against cancer cells in vitro while sparing normal cells
  • โ€ขTargets HDM-2 overexpressed on cancer cell membranes
  • โ€ขMechanism involves membrane pore formation independent of intracellular pathways
  • โ€ขActive against multiple cancer cell lines including solid and liquid tumors

Protocol Quick-Reference

Preclinical anticancer research targeting HDM-2 expressing cancer cells

Dosing

Amount

200-300 mcg for maintenance; 1-5 mg for aggressive research protocols

Frequency

3 times per week (maintenance) to daily (aggressive protocols)

Duration

Variable; no established human protocol

Administration

Route

SC

Schedule

3 times per week (maintenance) to daily (aggressive protocols)

Timing

No established optimal timing

Cycle

Duration

Variable; no established human protocol

Repeatable

Yes

Preparation & Storage

Diluent: Bacteriostatic water

Storage: Store lyophilized PNC-27 at -20 degrees Celsius, protected from light and moisture. Reconstituted stock solutions should be stored at 2-8 degrees Celsius and used within 7 days, or aliquoted and stored at -20 degrees Celsius for longer periods. Avoid repeated freeze-thaw cycles. For in vitro studies, prepare fresh working dilutions daily. Use low-binding tubes to minimize peptide adsorption to container surfaces.

โš—๏ธ Suggested Bloodwork (6 tests)

CBC with differential

When: Baseline

Why: Baseline immune cell counts; PNC-27 selectively targets cancer cells

CMP with liver enzymes

When: Baseline

Why: Liver and kidney function baseline

LDH

When: Baseline

Why: Baseline tissue damage marker (PNC-27 causes cell lysis)

Tumor markers (if applicable)

When: Baseline

Why: Relevant cancer-specific markers for tracking

CBC with differential

When: 2 weeks

Why: Monitor for any hematologic effects

LDH

When: 2 weeks

Why: Elevated LDH may indicate cell lysis activity

๐Ÿ’ก Key Considerations
  • โ†’Contraindication: Not approved for any human use; FDA has issued warnings against its use for cancer treatment; no safety data in any living organism

Subscribe to unlock this content

Get weekly peptide research summaries, new study alerts, and protocol updates โ€” free.

150+ peptide profiles ยท 30+ comparisons ยท 18 research tools

Already subscribed?
Mechanism of action for PNC-27
How PNC-27 works at the cellular level
Key benefits and uses of PNC-27
Overview of PNC-27 benefits and applications
Scientific Details
Molecular Formula
C188H293N53O44S
Molecular Weight
4031.7 Da
CAS Number
1159861-00-3
Sequence
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

What is PNC-27?#

PNC-27 is a synthetic chimeric peptide consisting of 32 amino acids, engineered by fusing two functional domains into a single molecule. The first domain, comprising residues 12-26 of the human p53 tumor suppressor protein, is the sequence responsible for binding to HDM-2 (human double minute 2, also known as MDM2). The second domain is a membrane residency peptide (MRP) derived from the third helix of the antennapedia homeodomain protein, which functions as a cell-penetrating sequence capable of interacting with and inserting into cell membranes.

The complete amino acid sequence of PNC-27 is: PPLSQETFSDLWKLL-KKWKMRRNQFWVKVQRG

The first 15 residues (PPLSQETFSDLWKLL) constitute the p53-derived HDM-2 binding domain. The remaining 17 residues (KKWKMRRNQFWVKVQRG) form the cell-penetrating MRP domain. This chimeric design is the key to PNC-27's proposed mechanism of action: the HDM-2 binding domain provides cancer cell selectivity by targeting a protein that is overexpressed on cancer cell membranes, while the MRP domain enables membrane insertion and pore formation.

PNC-27 was developed by researchers at the State University of New York (SUNY) Downstate Medical Center, with key contributions from the laboratories of Matthew Pincus and Ehsan Sarafraz-Yazdi. The peptide was designed based on the structural understanding that HDM-2 is expressed not only in the cytoplasm of cancer cells (where it inhibits p53) but also on the outer surface of cancer cell plasma membranes, providing an accessible target for extracellular therapeutic agents.

Mechanism of Action#

HDM-2 as a Membrane Target#

The central insight underlying PNC-27's design is that HDM-2, normally an intracellular protein that inhibits the p53 tumor suppressor, is also expressed on the plasma membrane surface of many cancer cell types but not on normal cells. This aberrant membrane localization provides a cancer-specific molecular target that is accessible from the extracellular space.

HDM-2 membrane expression has been confirmed in multiple cancer cell lines including pancreatic adenocarcinoma (MIA PaCa-2), melanoma, breast cancer, acute myeloid leukemia (U937, OCI-AML3, HL-60), and cervical cancer cells. Normal cells, including normal hematopoietic cells, fibroblasts, and epithelial cells, do not express detectable levels of HDM-2 on their membrane surface. This differential expression is the basis for PNC-27's selectivity.

Binding and Pore Formation#

PNC-27's mechanism of action proceeds through a distinct multi-step process:

  1. HDM-2 binding: The p53-derived domain of PNC-27 binds to the N-terminal domain (residues 1-109) of membrane-associated HDM-2, forming 1:1 complexes. The binding occurs in a p53 peptide-like conformation, with PNC-27 adopting an amphipathic helix-loop-helix structure upon contact with HDM-2.

  2. Membrane insertion: Upon binding membrane HDM-2, the MRP leader sequence inserts into the lipid bilayer. Conformational energy calculations suggest that in the PNC-27:HDM-2 complex, the leader sequence points away from the protein-protein interaction interface and toward the membrane.

  3. Pore formation: Multiple PNC-27:HDM-2 complexes aggregate in the membrane to form ring-shaped pore structures. Electron microscopy with gold-labeled antibodies has revealed layered ring structures containing both PNC-27 and HDM-2 in approximately 1:1 ratios near the cell surface, with pore diameters of approximately 6-15 nm.

  4. Necrosis: The transmembrane pores allow unregulated ion and water flux, leading to cell swelling and necrotic cell death. This is distinctly different from apoptosis: PNC-27 induces cell death through membrane disruption rather than activation of intracellular death pathways. This necrotic mechanism bypasses many common cancer resistance mechanisms that involve defective apoptotic machinery.

Mitochondrial Disruption#

More recent research (2024) has demonstrated that PNC-27's anticancer activity extends beyond plasma membrane disruption. The peptide also enters cancer cells and interacts with mitochondrial membranes, causing mitochondrial disruption. This dual mechanism, targeting both the plasma membrane and mitochondria, may contribute to the potency of PNC-27's anticancer effects.

Selectivity Mechanism#

PNC-27's selectivity for cancer cells over normal cells is dependent on the presence of HDM-2 in the cancer cell plasma membrane. This has been demonstrated through several lines of evidence:

  • Cancer cell lines that express high levels of membrane HDM-2 are sensitive to PNC-27
  • Normal cells that do not express membrane HDM-2 are resistant
  • The degree of PNC-27 sensitivity correlates with the level of membrane HDM-2 expression
  • Blocking membrane HDM-2 with antibodies reduces PNC-27 cytotoxicity
  • PNC-27 and PNC-29 (a control peptide) show no cytotoxicity toward normal rat mononuclear cells

Cancer Types Studied#

PNC-27 has demonstrated anticancer activity in vitro against a range of cancer cell types:

Cancer TypeCell Lines StudiedKey Finding
Pancreatic adenocarcinomaMIA PaCa-2Selective membranolysis, sparing normal cells
MelanomaMultiple linesHDM-2 membrane binding confirmed
Acute myeloid leukemiaU937, OCI-AML3, HL-60Necrosis within 4 hours, sparing normal hematopoietic cells
Breast cancerMultiple linesActive against triple-negative subtypes
Cervical cancerHeLa and othersEnhanced killing when combined with ketone bodies
Ovarian cancerPrimary specimensEx vivo cytotoxicity demonstrated
Endometrial cancerPrimary specimensEx vivo cytotoxicity demonstrated

PNC-28 is a closely related peptide from the same research program. While PNC-27 contains the p53 HDM-2-binding domain fused to the MRP sequence, PNC-28 contains a different segment of the p53 protein fused to the penetratin cell-penetrating peptide. PNC-28 has been studied primarily in pancreatic cancer models and also induces tumor cell necrosis rather than apoptosis. The penetratin sequence in PNC-28 appears to be critical for its membrane-disrupting activity.

Current Status#

PNC-27 remains in the preclinical research stage. Despite promising in vitro results demonstrating selective cancer cell killing across multiple cancer types, no human clinical trials have been initiated. The peptide has not entered the regulatory approval pipeline in any jurisdiction.

Key challenges for clinical translation include:

  • Peptide stability: As a 32-amino acid peptide, PNC-27 is susceptible to proteolytic degradation in vivo
  • Delivery: Achieving effective concentrations at tumor sites while maintaining selectivity
  • Scale-up: Manufacturing pharmaceutical-grade PNC-27 under GMP conditions
  • In vivo validation: Limited published in vivo tumor regression data
  • Pharmacokinetics: Half-life, distribution, and clearance in living organisms not well characterized

Evidence Gaps and Limitations#

The current evidence base for PNC-27 has significant limitations:

  • No completed human clinical trials of any phase
  • Very limited published in vivo data; most evidence comes from cell culture studies
  • The laboratory of origin (SUNY Downstate) has produced the majority of publications, with limited independent replication
  • Pharmacokinetic properties in vivo are poorly characterized
  • Whether the selective membrane expression of HDM-2 observed in cell lines reflects the situation in human tumors in vivo is uncertain
  • Long-term safety data is completely absent
  • Interaction with the immune system (immunogenicity, potential immune activation from necrotic cell death) has not been studied
  • The peptide's stability and bioavailability in physiological conditions require further characterization

Key Research Findings#

PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis, published in Biomedicines (Sarafraz-Yazdi E et al., 2022; PMID: 35625682):

  • The study showed 1 of 1 stoichiometry of PNC-27:HDM-2 complexes confirmed

Stay current on PNC-27 research

We summarize new studies, safety updates, and dosing insights โ€” delivered biweekly.

Community Protocols Available

See real-world usage patterns alongside the clinical evidence above. Community-sourced, not clinically verified.

Based on 3+ community reports

View community protocols

Frequently Asked Questions About PNC-27

Explore Further

โš ๏ธ

Medical Disclaimer

This website is for educational and informational purposes only. The information provided is not intended to diagnose, treat, cure, or prevent any disease. Always consult with a qualified healthcare professional before using any peptide or supplement.

You Might Also Like

Related content you may find interesting