Skip to main content
🧬Peptide Protocol Wiki

Neuropeptide Y: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Research compiled by Peptide Protocol Wiki
📅Updated February 12, 2026
Citations Verified

📌TL;DR

  • Molecular formula: C190H287N55O57
  • Molecular weight: 4253.72 Da
  • Half-life: ~15-30 minutes (plasma)

Amino Acid Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

40 amino acids

Formula

C190H287N55O57

Molecular Weight

4253.72 Da

Half-Life

~15-30 minutes (plasma)

PDB ID

1RON
3D molecular structure of Neuropeptide Y
Three-dimensional representation of Neuropeptide Y
Amino acid sequence diagram for Neuropeptide Y
Color-coded amino acid sequence of Neuropeptide Y

Molecular Structure#

Neuropeptide Y (NPY) is a 36-amino acid peptide with a C-terminal amide. It adopts the characteristic PP-fold (pancreatic polypeptide fold) tertiary structure: an N-terminal polyproline helix (residues 1-8), a beta-turn (residues 9-14), and a long amphipathic alpha-helix (residues 15-36) that pack against each other through hydrophobic interactions.

Amino Acid Sequence#

PropertyValue
SequenceYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Length36 amino acids
Molecular weight4253.72 Da
Molecular formulaC190H287N55O57
CAS number82785-45-3
PDB ID1RON
FamilyPancreatic polypeptide family (NPY, PYY, PP)
C-terminusAmidated (essential for bioactivity)

Receptor Binding#

NPY interacts with five receptor subtypes (Y1-Y5), all G protein-coupled receptors that signal through Gi/Go:

ReceptorDistributionPrimary Function
Y1Cortex, hippocampus, amygdalaAnxiolysis, anti-depression, vasoconstriction
Y2Hippocampus, hypothalamusPresynaptic autoreceptor, memory
Y4Gut, brainstemFeeding, GI function
Y5HypothalamusAppetite stimulation

The C-terminal pentapeptide (residues 32-36) is critical for receptor binding, with the terminal Tyr-NH2 being absolutely required for biological activity.

Pharmacokinetic Properties#

ParameterDetails
Half-life~15-30 minutes (plasma)
RouteIntranasal (clinical trials), IV/ICV (research)
BBB penetrationPoor (requires intranasal delivery for CNS access)
MetabolismDipeptidyl peptidase IV (DPP-IV) cleaves N-terminal residues
Key metaboliteNPY(3-36), which is Y2/Y5-selective

NPY is rapidly degraded in plasma by dipeptidyl peptidase IV (DPP-IV), which cleaves the N-terminal Tyr-Pro to produce NPY(3-36). This metabolite loses Y1 affinity but retains Y2 and Y5 activity, functionally shifting the receptor selectivity profile.

Stability Characteristics#

NPY is relatively stable as a lyophilized powder stored at -20 degrees C. In solution, it is susceptible to enzymatic degradation. The PP-fold tertiary structure provides some resistance to general proteases, but the N-terminus is vulnerable to DPP-IV.

Molecular Context#

Neuropeptide Y belongs to the Neuropeptide category of research peptides. The molecular properties of Neuropeptide Y determine its pharmacological behavior, including receptor binding, distribution, metabolism, and elimination. Understanding these properties is fundamental to interpreting clinical data and designing research protocols.

Structural Overview#

Neuropeptide Y is characterized as: Neuropeptide Y is a 36-amino acid C-terminally amidated peptide with a characteristic PP-fold (pancreatic polypeptide fold) structure consisting of an N-terminal polyproline helix (residues 1-8) connected by a beta-turn (residues 9-14) to a long amphipathic alpha-helix (residues 15-36). The C-terminal amidated tyrosine is essential for receptor binding..

Amino Acid Sequence Details#

The amino acid sequence of Neuropeptide Y is: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2. This sequence determines the peptide's three-dimensional structure, receptor binding properties, and biological activity.

Pharmacokinetic Profile#

Half-Life: ~15-30 minutes (plasma)

The half-life of a peptide influences dosing frequency, duration of effect, and the clinical utility of the compound. Researchers should consider the half-life when designing experimental protocols.

Frequently Asked Questions About Neuropeptide Y

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer