Skip to main content
🧬Peptide Protocol Wiki

IGF-1 LR3: Molecular Structure

Chemical properties, amino acid sequence, and structural analysis

Research compiled by Peptide Protocol Wiki
📅Updated January 29, 2026
Citations Verified

📌TL;DR

  • Molecular formula: C400H625N111O115S9
  • Molecular weight: 9111.4 Da
  • Half-life: Approximately 20-30 hours (estimated, due to reduced IGFBP binding)

Amino Acid Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

83 amino acids

Formula

C400H625N111O115S9

Molecular Weight

9111.4 Da

Half-Life

Approximately 20-30 hours (estimated, due to reduced IGFBP binding)

3D molecular structure of IGF-1 LR3
Three-dimensional representation of IGF-1 LR3
Amino acid sequence diagram for IGF-1 LR3
Color-coded amino acid sequence of IGF-1 LR3

Molecular Structure and Overview#

IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is an 83-amino acid recombinant protein analog of human IGF-1 with a molecular weight of approximately 9111.4 Da (CAS: 946870-92-4). The native human IGF-1 protein is a 70-amino acid single-chain polypeptide containing three intramolecular disulfide bonds that stabilize its tertiary structure into a compact fold resembling that of proinsulin. IGF-1 LR3 retains this core fold while incorporating two targeted modifications at the N-terminus that collectively alter its interaction with IGF binding proteins without impairing receptor engagement.

The full amino acid sequence of IGF-1 LR3 spans 83 residues, making it too long for concise single-line representation, but can be conceptually divided into the 13-amino acid N-terminal extension peptide followed by the modified 70-amino acid IGF-1 core sequence bearing the Arg3 substitution.

Structural Modifications#

The Arg3 Substitution (R3 Modification)#

In native human IGF-1, position 3 of the mature sequence is occupied by a glutamic acid (Glu3) residue. In IGF-1 LR3, this residue is replaced with arginine (Arg3). This single amino acid substitution changes the local charge from negative (glutamic acid, pKa approximately 4.1) to positive (arginine, pKa approximately 12.5) at physiological pH. Structural studies of IGF-1 in complex with various IGF binding proteins have demonstrated that the N-terminal region, including position 3, forms critical electrostatic contacts with the binding cleft of IGFBPs. The charge reversal at position 3 disrupts these interactions, substantially reducing the affinity of the modified protein for IGFBPs.

The R3 substitution alone has been shown to reduce IGFBP binding affinity significantly, but the effect is further enhanced by the second modification.

The 13-Amino Acid N-Terminal Extension (Long Modification)#

The second modification is the addition of a 13-amino acid peptide to the N-terminus of the protein. The extension sequence is Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn (MFPAMPLSSLFVN). This extension adds steric bulk to the N-terminal region of the protein, creating physical interference with the IGFBP binding interface. The N-terminal extension does not form a well-defined secondary structure but rather projects away from the core IGF-1 fold, creating a flexible appendage that clashes with the binding groove present in IGFBPs.

Together, the Arg3 substitution and the 13-amino acid extension increase the total length of the polypeptide chain from 70 to 83 amino acids and increase the molecular weight from approximately 7649 Da (native IGF-1) to approximately 9111.4 Da.

IGFBP Evasion Mechanism#

The combined effect of both structural modifications is a reduction in IGFBP binding affinity of greater than 100-fold compared to native IGF-1. Under physiological conditions, approximately 98-99% of circulating native IGF-1 is sequestered by one of six IGF binding proteins (IGFBP-1 through IGFBP-6). The majority of IGF-1 in blood circulates in a 150 kDa ternary complex consisting of IGF-1, IGFBP-3 (or IGFBP-5), and the acid-labile subunit (ALS).

This binding protein system serves as a reservoir and regulatory mechanism, extending the circulating half-life of native IGF-1 from approximately 10-12 minutes (free form) to approximately 12-16 hours (in the ternary complex) while simultaneously limiting the concentration of free IGF-1 available to activate the IGF-1 receptor. IGFBP proteases, including pregnancy-associated plasma protein-A (PAPP-A), cleave IGFBPs at target tissues to release free IGF-1 for local receptor activation.

IGF-1 LR3 largely bypasses this regulatory system. Because it binds IGFBPs with dramatically reduced affinity, IGF-1 LR3 remains predominantly in its free, bioactive form. This means that a given dose of IGF-1 LR3 produces a much higher effective free concentration of growth factor compared to an equivalent dose of native IGF-1.

The practical consequence is that IGF-1 LR3 exhibits substantially greater potency than native IGF-1 in biological systems containing IGFBPs. In serum-containing cell culture media (where IGFBPs are present), IGF-1 LR3 is typically 2-3 fold more potent than native IGF-1 on a molar basis. In serum-free conditions (where IGFBPs are absent), the two proteins show comparable activity, confirming that the enhanced potency of IGF-1 LR3 is attributable to IGFBP evasion rather than enhanced intrinsic receptor affinity.

IGF-1 Receptor Binding Preservation#

The structural basis for preserved IGF-1R binding lies in the spatial separation of the IGFBP and IGF-1R interaction surfaces on the IGF-1 molecule. The IGF-1 receptor binding interface involves residues located primarily in the B domain helix (approximately residues 1-29 of the mature sequence, particularly residues in the central helix) and portions of the A domain. Key receptor-contact residues include those involved in binding to the L1 domain and cysteine-rich region of the IGF-1R alpha subunit.

Critically, these receptor-contact residues are distinct from the residues at position 3 and the N-terminal region that are most important for IGFBP binding. The R3 substitution occurs at a position that is part of the IGFBP contact surface but is not a major determinant of IGF-1R binding. The 13-amino acid N-terminal extension projects away from the receptor-binding face of the molecule and does not sterically interfere with IGF-1R engagement.

As a result, IGF-1 LR3 activates the IGF-1R with essentially the same potency as native IGF-1. Upon binding, the IGF-1R undergoes autophosphorylation and triggers the canonical downstream signaling cascades: the PI3K/Akt/mTOR pathway (promoting protein synthesis, anti-apoptosis, and glucose uptake) and the Ras/MAPK/ERK pathway (promoting cell proliferation and differentiation).

Extended Bioavailability and Half-Life#

The half-life of native free IGF-1 in circulation is extremely short, approximately 10-12 minutes, due to rapid renal clearance of the small (7.6 kDa) unbound protein. When bound in the ternary complex with IGFBP-3 and ALS, the effective half-life extends to 12-16 hours because the 150 kDa complex is too large for glomerular filtration.

IGF-1 LR3 presents a distinct pharmacokinetic situation. Because it does not bind efficiently to IGFBPs and does not form the protective ternary complex, it is not subject to the same reservoir effect that extends the half-life of native IGF-1. However, at 9.1 kDa it is slightly larger than native IGF-1, and its reduced binding protein sequestration means it is not rapidly cleared from the interstitial space in the same manner as native free IGF-1. The estimated functional half-life of IGF-1 LR3 is approximately 20-30 hours, though this figure is based on in vitro bioactivity persistence and limited preclinical data rather than formal human pharmacokinetic studies.

This extended bioavailability, combined with the high free fraction, is the primary reason IGF-1 LR3 has become the preferred IGF-1 variant for cell culture and bioprocessing applications. A single addition of IGF-1 LR3 to culture media provides sustained growth factor activity over a longer period than native IGF-1, reducing the frequency of media supplementation required.

Physicochemical Properties#

PropertyValueNotes
Total amino acids8313-AA extension + 70-AA modified IGF-1 core
Molecular weight~9111.4 DaCalculated from amino acid composition
CAS number946870-92-4Unique chemical identifier
Disulfide bonds3 intramolecularConserved from native IGF-1 (Cys6-Cys48, Cys18-Cys61, Cys47-Cys52, native numbering)
Isoelectric pointApproximately 8.4 (predicted)Shift from native IGF-1 due to Glu-to-Arg substitution
SolubilitySoluble in aqueous buffers at physiological pHTypically supplied lyophilized; reconstituted in sterile water or buffered saline
Storage (lyophilized)-20 to -80 degrees CStandard protein storage; protect from moisture
Storage (reconstituted)2-8 degrees C, use within daysAvoid repeated freeze-thaw cycles
IGFBP bindingReduced more than 100-fold vs native IGF-1Combined effect of R3 substitution and N-terminal extension
IGF-1R affinityComparable to native IGF-1Receptor binding site not affected by modifications

Structural Characterization Limitations#

The three-dimensional structure of IGF-1 LR3, including the conformation of the 13-amino acid N-terminal extension peptide, has not been determined by X-ray crystallography or cryo-electron microscopy. Structural understanding is inferred from the known structure of native IGF-1 (multiple PDB entries available) and from biochemical binding studies. The N-terminal extension is predicted to be largely unstructured and flexible based on its amino acid composition, which lacks strong secondary structure propensity.

The cross-reactivity of IGF-1 LR3 with insulin receptor isoforms (IR-A and IR-B) and the IGF-2 receptor (also known as the cation-independent mannose-6-phosphate receptor) at concentrations used in typical experiments has not been fully characterized. Native IGF-1 can activate the insulin receptor, particularly the IR-A isoform, at supraphysiological concentrations. Whether the structural modifications in IGF-1 LR3 alter this cross-reactivity profile remains an open question relevant to the interpretation of research results.

Frequently Asked Questions About IGF-1 LR3

Explore Further

Disclaimer: For educational purposes only. Not medical advice. Read full disclaimer